KEGG   Papaver somniferum (opium poppy): 113328277Help
Entry
113328277         CDS       T05758                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF EGF_3 WAK Plasmod_Pvs28 Haspin_kinase FXa_inhibition PIP49_C EGF
Motif
Other DBs
NCBI-GeneID: 113328277
NCBI-ProteinID: XP_026431178
Position
Unknown
AA seq 658 aa AA seqDB search
MGDSHVLVKFQCFTFLWLWLQVGAAEIPTNTSRPITKPGCRDRCGNVSIPYPFGIGEGCS
AGGYFELTCEDSYFDSALPTYEDYNFSKISIPDGHITALLWVSMDCSDEKMPGWTTFNHF
SPFTLSNTKNKFIAMGCDTYAFLQLGDKRDNTALGCTSVCDTMEDISDGSCTGFGCCEAS
IPPGIGSYNITVRSVGETRRNLSFNPCSYAFLIEESSFQFSKSYLKDFLNNGNGVVPVVV
DWTIGTETCEIAKTNLTSYACGPNTICTSSNVSSGYRCNCKKGYEGNPYLNSSTGGECQD
VDECYEKRYEKRCRIETNICINTEGGYTCPCKHGFYSQHEKNGISDCIPRLSNSNRIVVG
VCLGLALLVVSLVASFWLYWGYRKRKHMQVKEEFFKQNGGLILNRLLYEREEDTETFRNR
RGGRKHRSVATIYTEKELRKATDNYHESHILGRGGFGTVYKGILSNGTVVAIKKTKVVDM
NQNEQFINEIAVLSQINHKNVVQLLGCCLETEVPLLVYEFVTNGTLHQHLHKGRDNQTGY
ATLSWENRLRIALEVAGALTYLHAEASIPIIHRDVKSSNVLLDDDYKAKVSDFGASRLNP
TDQAQLSTVVQGTFGYLDPEYMQSNKLTEKSDVYSFGVLLVELLTEIWQGMIMNGSVV
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgggggattcacatgttcttgtgaagtttcagtgtttcactttcttatggctatggctg
caagtaggagctgcagaaataccaaccaatacttcccgtccaataaccaaacctggttgc
cgagatcgctgcgggaatgtcagcataccttacccatttggtattggtgaaggttgttct
gcaggtggttacttcgagttaacatgcgaagatagttacttcgattccgccctacccact
tacgaggactacaatttctcaaagatatcaataccggacggccatataacggcgcttctc
tgggtttccatggattgttccgatgagaaaatgccaggctggacaacgtttaaccatttt
tcaccgttcacattgtctaatacaaaaaacaagttcatagccatgggttgcgacacctac
gcatttctacaacttggagataaacgagataatacagccctgggatgtacgtcagtctgt
gataccatggaagatatcagtgatggttcatgcactggttttggttgctgtgaggcctca
attccacctggaataggttcatataacatcacagttcgaagcgtgggtgaaacccgaagg
aatttgagtttcaatccgtgcagttatgcctttttgattgaagaaagttcgtttcagttt
tctaaatcttacctcaaagatttcttgaataatgggaacggagtggttccggtggtcgtc
gattggactattggtactgaaacatgtgaaatagctaaaacaaatctgactagctatgca
tgtggaccaaatactatctgcacatccagtaatgtttcgtcaggttatcgttgtaactgt
aaaaagggatatgaagggaatccttacctgaacagtagtaccggtggtgaatgccaagat
gttgatgaatgctatgagaaacgatatgagaaacgatgtagaattgaaacaaatatttgc
attaatacggaagggggatacacatgtccttgcaaacatggattctattctcaacacgaa
aaaaatggcatctcagattgcattccccgtctgagtaactccaacaggattgttgttggt
gtgtgcttaggcttagctcttctagtggtgagccttgtggctagcttctggttgtactgg
ggatataggaaaagaaagcacatgcaagttaaggaggaattcttcaagcaaaatggtggg
ttgattttgaatcgtcttctttatgaacgggaagaagatactgagacgtttcgaaataga
aggggaggaagaaaacaccggtcagttgctacaatatacaccgagaaggagctgaggaag
gcgacagataactatcatgaaagtcacattcttggacgaggagggtttggcacggtgtat
aaaggcatcttatctaacggaaccgtggttgcaattaagaagacaaaagttgtcgatatg
aaccaaaatgagcagttcataaatgaaattgctgttctgtcacaaattaatcacaaaaat
gtggtgcagctcttgggttgttgtctagaaaccgaagttcctttactagtttatgaattt
gtaactaacgggacgcttcaccagcacttgcacaaaggacgtgacaaccagactggttat
gcaacactctcatgggaaaatcgtttgaggatagcattggaagttgcaggagcattaact
tacttgcacgctgaagcttccatacccatcatccatagagacgtcaagtcaagtaatgta
cttctagatgatgattacaaagcaaaagtttcggatttcggtgcttctaggctaaaccct
acggatcaagctcagctaagcacagtagttcaaggcacttttgggtacttggacccagaa
tatatgcagtctaacaagctaacagagaaaagcgacgtgtacagctttggtgttttgctt
gtggaattgctaacagaaatttggcaaggtatgataatgaacggatcagtagtgtag

DBGET integrated database retrieval system