KEGG   Papaver somniferum (opium poppy): 113328798Help
Entry
113328798         CDS       T05758                                 

Definition
(RefSeq) tryptophan decarboxylase TDC2-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00350  Tyrosine metabolism
psom00360  Phenylalanine metabolism
psom00380  Tryptophan metabolism
psom00950  Isoquinoline alkaloid biosynthesis
psom00965  Betalain biosynthesis
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113328798
   00360 Phenylalanine metabolism
    113328798
   00380 Tryptophan metabolism
    113328798
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    113328798
   00950 Isoquinoline alkaloid biosynthesis
    113328798
   00965 Betalain biosynthesis
    113328798
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113328798
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     113328798
    4.1.1.105  L-tryptophan decarboxylase
     113328798
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113328798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 113328798
NCBI-ProteinID: XP_026431593
Position
Unknown
AA seq 513 aa AA seqDB search
MGSLDDTKFTETSILSEFKALDPEEFRKQAYQTIDFIVDYYKNIEKYPVLSQVQPGFLRN
SFPSTPPYKPEPFENILKDVQTQIIPGMTNWLSPNFFAYFPATVSTAGFMGEMLSTCFNS
VGFNWLSSPAATELEMVVMDWFADMLKLPSIFKFSGSGGGVIQGTTSEAILCTLVAARDR
ALDRIGGDNIGKLIVYGSDQTHSTFVKACKIAGILPCNVRSLPTTTDMDFSLSPALVREA
VETDVANGFVPIYLCLTVGSTSSNATDPIDQFSDVASDYGIWLHVDAAYAGSACICPEFR
HYLNGIEGVDSFSLSPHKWFLTYLDCCCLWVKQPSLLIKALSTNPEYLKNKPSESNLVID
YKDWQVGTGRKFRSLKLWLVLRSYGVENLQSHIRSDVRMAEVFEDFVRNDPQFEIVVPRR
FTLVCFRWNPSSGLAPAGYNVELLNRKLLDWINSTGQIYMTHTIVGGVYMLRFAVGATLT
EESHVIAAWNLIKKGTDTLLVDRSPGYSNCDFN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggggagtttagatgacacaaaatttacagaaacctcaattcttagtgagtttaaggca
ttggatccggaagagttccgtaaacaagcttaccaaaccattgatttcattgttgattat
tacaaaaacatagaaaaatatccagttctttctcaagttcaacctggttttcttcgaaat
agtttcccaagtactccaccatataaaccagaaccatttgagaatatcttaaaagatgtt
caaactcaaataataccgggtatgacgaactggttaagtcccaactttttcgcgtatttt
cctgcaactgttagtactgctggtttcatgggtgaaatgctttctacttgttttaattct
gttggtttcaattggctttcatctcctgctgctactgaacttgagatggtcgtcatggac
tggtttgctgacatgctcaaacttcctagcatctttaagttttctggttcaggtggtggt
gttatacaaggaaccacaagtgaagctattctttgtacgctagtagcagcaagagatcgc
gcgctggaccgtattggcggtgataatattggaaagttaatcgtttatggctccgatcaa
actcactcgacatttgtgaaggcatgtaaaattgctggcattttaccttgtaacgtaaga
tcgttaccaacaacaaccgacatggacttttctctatcccctgctcttgtccgtgaggct
gttgaaactgatgttgcaaatggatttgtaccgatttatctctgcttaactgtgggtagt
acatcatctaacgccacagatccaatcgatcaattttctgacgtagcaagtgattatgga
atttggctgcatgtggatgctgcttacgcaggcagtgcatgtatttgtcccgagtttcga
cattatttgaatggaattgaaggagttgactcctttagtctaagccctcacaaatggttt
ctcacttacttggattgttgttgtttgtgggttaaacaacctagtttacttataaaagct
ctaagtaccaacccagagtacttgaagaacaaacctagtgagtcgaacttagtcatcgac
tataaggattggcaagttggaactgggcgtaaatttcgatctttaaaactatggctcgtt
cttcgcagttacggtgtagagaatctgcaaagccacataagaagtgacgttagaatggct
gaagtgttcgaagactttgtccgaaatgatccacagttcgagattgtcgttccgagacgg
tttacattggtatgtttccgctggaacccaagttctggtttggcacctgcaggttataat
gttgagttgttgaatcgtaagttacttgactggatcaattcaactggacaaatttacatg
actcacacgatcgttggaggtgtgtacatgctgaggtttgctgtaggagccacattaaca
gaagagtcccatgtcattgctgcatggaacttgatcaagaaaggaactgatacattgctc
gttgataggtctcccggatattctaattgtgactttaattaa

DBGET integrated database retrieval system