KEGG   Papaver somniferum (opium poppy): 113329642Help
Entry
113329642         CDS       T05758                                 

Definition
(RefSeq) leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal PIP49_C
Motif
Other DBs
NCBI-GeneID: 113329642
NCBI-ProteinID: XP_026432281
Position
Unknown
AA seq 214 aa AA seqDB search
MEVDSSSPLFLFSFVYNSEEEEQGNLVHGFNAEIQILGRIRHRNIVRLLGFCSNHETNLL
VYEYMPNGSLGEVLHGEKGGDLHWDTRYKIAVEAARGLCYLHHDCSPLILHRDVKSNNIL
LDSNFDARVADFGLAKFLQDSGTSEYMSAIAGSYGYIAPGKINEFSTCILFWYLELLSGR
KPVGDFGDGVGIVHWDTTDSKSSGVLKILDPRLP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagatagctcttctcctctctttctcttctccttcgtctacaacagtgaagaa
gaagagcaagggaatctcgttcacgggtttaatgcagagattcagattttgggtaggatt
agacatcgcaatatcgtgaggttattaggattttgttccaaccatgagaccaatcttttg
gtttatgagtacatgcctaatggaagtttaggtgaagttcttcatggagaaaaaggaggt
gatttgcattgggatactaggtataaaattgcagttgaagctgcaagagggttgtgttat
ctgcaccatgactgttctcctctgattcttcaccgggatgtgaaatcgaacaatattctt
ctagattccaactttgatgctcgagtcgctgattttggacttgctaaatttcttcaagat
tctggtacttctgaatacatgtctgctattgccggctcttatgggtatattgcaccaggt
aagattaatgaattcagtacatgcattttattttggtatttagaactactgagtggtaga
aaaccagttggtgattttggagatggagttggtattgttcattgggatacgacagattca
aaatcatcaggagttttgaagattcttgatccaagacttccttag

DBGET integrated database retrieval system