KEGG   Papaver somniferum (opium poppy): 113331884Help
Entry
113331884         CDS       T05758                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP59-like
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113331884
   03110 Chaperones and folding catalysts [BR:psom03110]
    113331884
Enzymes [BR:psom01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     113331884
Spliceosome [BR:psom03041]
 Complex C
  Other components
   PPlases
    113331884
Chaperones and folding catalysts [BR:psom03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    113331884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-CCHC
Motif
Other DBs
NCBI-GeneID: 113331884
NCBI-ProteinID: XP_026434312
Position
Unknown
AA seq 309 aa AA seqDB search
MSTSEYCVWYGGCSRTIDGEVRFEDDWVPMDEQLGAGELEEVIRQKEAHFSAVVLQSIGD
IPDADLKPPENGLFICKLNPITEDRDLRTIFSGSGTVIFTKVMRNFKTGDSLGYAFIEFE
TKEVCEEAYLNMHNASIDGRRIHVDFIQSVSKLWSEYRRKEHLTGKGRGCFKCGSLDHMA
KDCTGDLTIKSENLKYVLKDGNTQHGENENYEKVFDGETTDGSGCEKRWGKRVSDKDPKK
RRVHIESENDLRYKGQDSRDTRSDESSHDNRSRGRDREDESSQGSRHGGSRRLENEEYET
REKWTGPGV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacttctgaatactgtgtgtggtatggtggttgctcacgaacaattgatggcgag
gtgcgattcgaagatgattgggtgcctatggatgaacaactgggtgcaggagagcttgag
gaggttattcggcaaaaggaggcgcatttcagtgctgtggttcttcagagtattggtgac
attcctgatgctgatttgaaacctccagaaaacgggttattcatttgcaagcttaatcca
attactgaggacagagatttaagaacaattttttcaggctctggaactgtaatattcaca
aaggtgatgcgtaattttaaaactggagatagcttaggctatgcttttatcgaatttgaa
acaaaggaggtctgtgaagaagcctatttgaatatgcacaatgcttccattgatggtcgg
aggatacatgtggactttattcagagtgtatctaagctgtggtctgaatacaggcgtaaa
gagcatctaactggtaaagggagaggttgtttcaaatgtggttcccttgatcacatggcc
aaagattgcactggagaccttactattaaatcagaaaatctaaagtatgttctaaaagat
gggaatacccagcacggtgaaaatgagaattatgagaaggtattcgatggagagaccact
gatggttctggatgcgaaaagagatggggaaaacgtgtctcggataaagatccaaagaaa
cgaagggttcacatagaaagtgagaatgacctgagatataaagggcaggacagtagggac
acgagaagtgatgaaagtagccatgataatagaagtagaggaagagatagagaggatgag
agctcccaagggagtaggcatggtggaagcagaagactcgagaatgaggagtacgagaca
agggagaagtggacaggaccaggagtgtaa

DBGET integrated database retrieval system