KEGG   Papaver somniferum (opium poppy): 113334097Help
Entry
113334097         CDS       T05758                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113334097
NCBI-ProteinID: XP_026436219
Position
Unknown
AA seq 198 aa AA seqDB search
MDPSTFGAEEKEDDVLESGKFGKWTSSGREKAFQGFRTRLEEFKNEVLVISKLQHRNLVR
LLGCCTEREEKILVYEYMPNKSLDAFLFVPTQRTLLDWRKRFHIIEGITRGILYLHRDSR
FRVIHRDLKASNVLLDEKLNPKISDFGMARIFGGDELQADTRRVVGTYGYMSPEYAMEGR
FSEKSDVFFKFVKIISFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggatccatctacatttggagctgaagagaaggaggatgacgtcttagagtcaggcaaa
tttggtaaatggacaagtagtggccgtgaaaaggctttccaagggttccggacaaggcta
gaagagttcaaaaatgaagttctggtgatctctaaacttcaacacaggaatctagttaga
cttttaggttgttgcactgaaagggaagagaagatattggtatatgaatacatgcctaac
aaaagcttggatgcatttctctttgttccaacccaacgaacgctcctggattggaggaaa
cgcttccatattatcgaagggataacccgtgggattctttaccttcacagagattctaga
ttcagagttattcatagagatttgaaggcaagtaacgttttgctggatgaaaagttgaac
cctaaaatttccgattttgggatggcaaggatatttggaggcgatgagctccaggcagat
accagaagagttgttgggacatacggttatatgtcccccgaatatgcaatggaaggtcga
ttttcagaaaaatcagatgttttctttaagtttgtaaagattatttcgtttagttag

DBGET integrated database retrieval system