KEGG   Papaver somniferum (opium poppy): 113338793Help
Entry
113338793         CDS       T05758                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113338793
Enzymes [BR:psom01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     113338793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 113338793
NCBI-ProteinID: XP_026439964
Position
Unknown
AA seq 501 aa AA seqDB search
MTWFRNLLTTSSIKSKTLINPYPKFIFTSLTHFSSESAATTTETSKSPYTPTYSGLEPTK
PNEKPRVVVLGTGWAASRLMKGINTDIYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAE
PIGRIQPAISKAPGSYFFLANCKGVDAENHMIHCETVTESLDTLNPWKFKVSYDKLIIAS
GAEASTFGIHGVKDHAIFLREVAHAQEIRRKLLLNLMLSDVPGITEDEKRRLLHCVVIGG
GPTGVEFSGELSDFILKDVHERYAHVKDYIHVTLIEANEILSSFDVRLRDYATKQLTKSG
VRLVRGIVKDVQPQKIILNDGTEVPYGLLVWSTGVGPSSFVKATEFPKSPGGRIGVDEWL
RVPSVQDVYSIGDCCGFLESTGKPVLPALAQVAERQGKYLAHLLNKIGKNGGGRANSAED
MELGGPFVYRHLGSMATVGRYKALVDLRQSKDAKGVSIAGFSSWFIWRSAYLTRVVSWRN
RFYVAVNWATTFVFGRDISRI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacttggtttagaaatcttcttacaacatcatcaatcaaatcaaaaaccttaattaac
ccgtatccgaaattcattttcacatctctgactcatttcagttctgaatcggcggcaact
acgactgaaaccagtaaatctccatatacaccgacgtattcaggacttgaaccaacgaaa
ccaaatgagaaacctagggttgttgtgttgggaactggatgggcagcatcaagactcatg
aaaggaattaatactgatatatatgatgttgtttgtgtatcaccgaggaatcatatggtt
tttacaccattgttagcttctacttgtgttggtacgcttgagtttcgttctgttgctgaa
ccaattgggaggatacaacctgcaatttctaaagctcctggttcttacttctttcttgct
aattgtaaaggagttgatgctgagaatcacatgattcactgtgagactgtcacggaatcg
ttagacacactgaacccatggaaatttaaggtctcatatgacaagttaatcatagcatca
ggagcagaagcctcaacttttggaatccatggcgtgaaagaccatgccatttttcttcgt
gaagttgctcatgctcaagagatccgtaggaaactgctcctaaatttaatgctttcggat
gtgcccggtattactgaggatgaaaagagaaggctcttacattgtgttgttattggaggt
ggcccaacaggtgttgagttcagcggtgagcttagtgatttcatccttaaagatgttcat
gaaagatacgcccatgtgaaggattatatccatgtaaccttgattgaggcaaatgagata
ctatcgtcatttgatgttcgcctgcgggactatgcaactaagcaactgaccaagtcagga
gttcgccttgtacgtggaatcgtcaaggatgttcaacctcaaaaaattattcttaacgat
ggcacagaggtcccatatggtttgttggtatggtctacaggtgttggcccttcatcattt
gtaaaagctacggaatttccaaaatcaccaggtggcaggataggagtggatgagtggcta
cgggttccatctgtgcaggatgtctattccattggggattgttgtgggtttcttgaaagt
accggtaaacctgtacttccagctttagctcaggtggcagagagacagggaaaatatcta
gcacacttgctgaacaaaatcggtaagaatggtggagggcgtgcaaacagtgccgaagac
atggaacttgggggaccatttgtttatagacatttggggagcatggctactgttgggaga
tacaaagctcttgtcgacctaaggcaaagcaaggatgcaaaaggtgtatcaattgcagga
tttagtagttggttcatttggcggtcagcttatcttacccgtgtggtaagttggaggaat
agattctatgtggcagtcaactgggccacaacatttgtttttggtcgtgatataagtcgt
atctaa

DBGET integrated database retrieval system