KEGG   Papaver somniferum (opium poppy): 113343289Help
Entry
113343289         CDS       T05758                                 

Definition
(RefSeq) heat shock 70 kDa protein 3-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03040  Spliceosome
psom04141  Protein processing in endoplasmic reticulum
psom04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113343289
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113343289
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113343289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:psom01009]
    113343289
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:psom03041]
    113343289
   03009 Ribosome biogenesis [BR:psom03009]
    113343289
   03110 Chaperones and folding catalysts [BR:psom03110]
    113343289
   04131 Membrane trafficking [BR:psom04131]
    113343289
   03051 Proteasome [BR:psom03051]
    113343289
   03029 Mitochondrial biogenesis [BR:psom03029]
    113343289
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113343289
Protein phosphatases and associated proteins [BR:psom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113343289
Spliceosome [BR:psom03041]
 Complex B
  Other components
   Prp19 complex
    113343289
 Complex C
   Prp19-CDC5 complex
    113343289
Ribosome biogenesis [BR:psom03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113343289
Chaperones and folding catalysts [BR:psom03110]
 Heat shock proteins
  HSP70 / DNAK
   113343289
Membrane trafficking [BR:psom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113343289
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113343289
Proteasome [BR:psom03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113343289
Mitochondrial biogenesis [BR:psom03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113343289
Exosome [BR:psom04147]
 Exosomal proteins
  Proteins found in most exosomes
   113343289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 113343289
NCBI-ProteinID: XP_026443314
Position
Unknown
AA seq 147 aa AA seqDB search
MKSGSKNVITVKNNKGKLSSDEIKRMVQDSEKYKEDDEKHRKKVDLRNTFETYAIKMRSM
ISNNGGMLSSKDKKNIKNAVNNAVQWLESSELGKTDDIIDKMKALQNLCDPIVDKLYQQG
DTDSPPSTRSGSVASKFSKILRSFGFL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggtagtaaaaatgtgattactgtcaaaaataataagggaaagttgtcttct
gatgagattaagaggatggttcaggattctgagaaatacaaggaagatgatgaaaaacac
aggaagaaggtagacttaaggaacacctttgagacatatgcaatcaagatgaggagcatg
atcagtaataacggagggatgctatcatccaaggataaaaagaatatcaagaatgcagtc
aacaacgccgttcagtggttggaaagcagtgaacttggtaagacagacgatatcattgac
aagatgaaggcattacagaatttatgcgaccctatcgttgataagctgtaccagcagggt
gatactgatagccctccttcaacaagatcaggcagtgttgcatcaaaattttcgaaaatc
ttaagatcatttggtttcctctga

DBGET integrated database retrieval system