KEGG   Papaver somniferum (opium poppy): 113347228Help
Entry
113347228         CDS       T05758                                 

Definition
(RefSeq) serine/threonine receptor-like kinase NFP
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LysM Kinase-like Rax2
Motif
Other DBs
NCBI-GeneID: 113347228
NCBI-ProteinID: XP_026446622
Position
2
AA seq 623 aa AA seqDB search
MNIQNFFFLSFLLLVSLHNLQAQLAPNTRGYACTPTPLTYPCQTYVHYRAQSPNFQDLAN
ISDLFSLSRLMITKPSNLSPPTSPLLPQQSLLIPVTCSCSSDFKISFANLTYTIHGGDTF
YLVSSNHFQNLTTYQSVQIVNPKLVPTKLDIGDQVIFPIFCKCPNKTSTEAHQTNFLISY
VFQPSDNLSAIATKFESNQKSLVEINGGKENFSPYETIFIPVSKLPIFQQPTGISPVSQP
TGISPVSDNPRSSVRKGAVVGLSIGLGITVFMLILLISIMGFRFYKEKNEDKKVNKYQFG
KGESFDEENLMADVSDCLDKYRVYGIQDLKEATAGFSQSSLIHGSVYKGCIGGEFYAIKR
MKWNACEELKILQKVNHGNLVKLEGFCIDPQDDNCYLIYEFVDNGSLHSWLHGESNGVSK
KKLDWKTRLRIAIDVANGLQYIHEHTRPTVVHKDIKTSNILLDGNMRAKIANFGLAKSGC
NAITMNIVGTQGYIAPEYLEDGIVTTKMDVFAFGIVLLEIISGKEAIDEAGKVLWTNAHT
LLEGKEDEKHERLKRWMDLALVNGESCMLESITNVIAVAAACLQREASRRPSMVEVVYTL
SKSDDLYIDFSEDGLSVTPVLAR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacagaacttcttcttcctgtcatttctgttactagtttcacttcacaatctc
caagctcaacttgcaccaaacacaagaggttatgcatgtacgccaaccccattaacatat
ccatgtcaaacttatgttcattacagagctcaatctccaaattttcaagacttggcaaac
atttctgatcttttttcactgagtagacttatgatcacaaaaccaagtaacctttcaccg
ccaacttctccacttttaccccagcaatctcttttgattcctgtaacctgttcttgtagt
tcagatttcaagatatcttttgctaatcttacttacacaatccatggaggtgatactttt
tacttagtctcttccaatcatttccaaaacctcactacttatcagtccgttcaaattgtt
aatccgaaacttgtaccaactaaactcgatatcggtgatcaagtaattttcccaatcttt
tgtaaatgtccaaacaaaaccagcacagaggctcatcaaacaaattttctcatcagttat
gtttttcaaccttctgataatttatctgcaattgcaacaaaatttgaatcaaaccaaaaa
tcattggtagaaatcaatggaggaaaagaaaatttcagtccttatgaaacaattttcatt
ccagtttctaaactaccaattttccaacaacctactggtatttctcctgtttcacaacct
actggtatttctcctgtttctgataatccaagaagtagtgtgagaaaaggagctgttgtt
ggattatcaattggattaggaattacagtttttatgttaattctattgatttcaattatg
ggttttagattttacaaagaaaagaatgaagataagaaagtgaacaagtatcagtttggg
aaaggggaatcatttgatgaagagaatttaatggctgatgtttcagattgtttggataag
tatagagtttatggaattcaagatttgaaagaagcaactgctgggttctcacaaagttct
ttgattcatgggtctgtgtacaaaggatgcattggtggagaattctatgccatcaaaagg
atgaaatggaatgcttgtgaagagctcaagatcttacagaaggtaaaccatgggaatttg
gtgaagcttgagggtttctgtatagatcctcaggacgacaactgttatctcatatatgag
ttcgtcgataatggttctcttcattcatggcttcacggggaatctaatggcgtgtcaaaa
aagaaacttgattggaaaacaaggttaagaatcgccatcgatgttgcaaacggtctccag
tatatccatgagcacactaggccgacagtagtacataaagacataaagactagcaacatt
ctactagacggaaatatgagagccaagatcgctaactttggtcttgctaaatctggctgt
aatgccatcactatgaacattgttggaacccaaggttatattgccccggaatatctagaa
gacggaattgtaacaacaaaaatggatgtttttgcatttgggatagttttacttgagata
atttcaggcaaggaagctattgatgaagcagggaaggtcttatggaccaatgcacataca
cttttagagggaaaagaagacgagaaacatgagaggttaaagagatggatggatttggct
cttgttaatggggaatcttgcatgttagagagcatcacgaacgtaattgcagttgcagct
gcttgtttgcaacgagaagcttctcgaagaccgagtatggtagaagttgtttatacacta
tctaagagtgatgatttgtatatagatttctcagaggatggattatctgtaactccagtt
ttagctagatga

DBGET integrated database retrieval system