KEGG   Papaver somniferum (opium poppy): 113347365Help
Entry
113347365         CDS       T05758                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00020  Citrate cycle (TCA cycle)
psom00310  Lysine degradation
psom00380  Tryptophan metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113347365
  09105 Amino acid metabolism
   00310 Lysine degradation
    113347365
   00380 Tryptophan metabolism
    113347365
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     113347365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 113347365
NCBI-ProteinID: XP_026446791
Position
2
AA seq 474 aa AA seqDB search
MLAILRRKIASEGSNASCTIGQSLRTLRPFASSATRRYTAGSNETLFLRRGSKYVQNFSC
QILPGTAVTSKSMRELGCLLREDSKLQGWTRSFSSVNGDPVDVVVPFMGESITDGTLAAF
LKKPGDSVQIDEPIARVETDKVTIDVASPEAGVIQKFVAKEGDTVEPGTKIAVISKSGEG
ANVTPAAPSEGLNAVIETPKPSAPAEKEKNPSVETVVAKVKPETPSPAPYRASAIEPIHP
PKEREIKVRMTRLRKTVAERLKRAQDTFVLLTTFNEIDMTNLMNLRSEYKDAFLEKHGVK
LGFMSTFVKAAVSGLQEQPVINASIDGDDIIYRNYFDISVAVGSPKGLVVPVIRDAEKMN
FADIEKEIHRLAKKARDGSLSIDDMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSV
VSRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVLFLRRIKDVVEDPCRLLLDV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaattttaaggcgaaaaattgcttctgaaggctctaatgcttcttgtactata
gggcagtctttgcgtacactacgcccatttgcatcatctgcaacaagaagatacacagca
ggaagcaatgagaccctatttcttcgaagaggatctaagtatgtgcagaacttcagttgc
cagattttacctggtactgcagttacttcaaagtctatgagggagcttggctgcttactt
cgagaagattcaaagcttcaagggtggactaggtcattctcttcagttaatggtgaccct
gttgatgttgttgttcctttcatgggagaatctattacagatggtaccctagcagctttt
ttgaaaaaacctggagatagtgttcaaatcgatgagccaattgctcgggttgaaaccgat
aaggtaaccatcgacgttgctagtcctgaagctggagttatccagaagtttgtagccaaa
gaaggtgataccgtagaaccagggaccaaaattgcagtcatttcaaaatccggtgagggt
gcaaatgtgacacctgctgctccatctgagggtcttaatgctgttatagagactccaaag
ccatcagctcctgcagaaaaggagaaaaatccttcagtagaaactgttgttgccaaggtc
aaacctgaaacaccctccccagcgccatatagagcttcagctatagaacctattcatcct
cccaaagaaagggaaataaaagtacgaatgacaaggcttagaaagacagttgctgaacgc
ctgaaacgtgcgcaggacacgtttgttctcctgaccacttttaatgaaattgatatgact
aacctgatgaaccttcgttctgaatacaaggacgcctttttagaaaaacatggagtcaag
ttgggatttatgtcaacgtttgttaaggctgctgtcagtggtctccaggaacagccagtt
atcaacgcatccattgacggcgatgatatcatctatagaaactattttgatattagtgtt
gctgttggttctccaaagggtctggttgttccagttatccgggatgccgaaaaaatgaac
ttcgctgacattgagaaggagatccacaggctggcaaagaaggccagagatggttcacta
tccatcgatgatatggcaggaggctcctttaccatatcaaatggcggtgtatatggaagc
cttttaagcactcccataatcaaccctccacagtcggccatcttgggtatgcattcagtc
gtcagccgtcctatggtagttggtggcagtgttgttccaaggccaatgatgtacgttgca
ctgacatatgatcaccgactgattgatgggagagaggctgttctctttttacgccgtata
aaagatgtcgttgaggacccttgcagacttctccttgacgtatga

DBGET integrated database retrieval system