KEGG   Papaver somniferum (opium poppy): 113348632Help
Entry
113348632         CDS       T05758                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
Organism
psom  Papaver somniferum (opium poppy)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung APH ETRAMP Pkinase_fungal Haspin_kinase PRIMA1 TMEM154 UL45 Pox_EPC_I2-L1 Orf78 DUF4366 ASFV_J13L DUF4519
Motif
Other DBs
NCBI-GeneID: 113348632
NCBI-ProteinID: XP_026448260
Position
2
AA seq 686 aa AA seqDB search
MNNPSYILIIFIHQKPAKPKIGSYIFRLISSAVILLIHVNNDKVIAQPTYERQYYCQGDN
YTNPSQFQVNLNKVLSSLSSNITTTNRKFFYSSIGENMDKVYGILLCRGDITRQETCKSC
VEIAISELAVRCPNTKEYVTWYTHCMLRYSDKNIFYVMETEPELTFNSESNLTNQMEFKD
IVIQLMQGLVRNATTNANHDGTLFFATGSSTDTVYGLVQCTTDISTTDCSDCLMGAVSDI
DLCHYGKRSGLVLRPSCNIRYDSYPFYESKQATNSGSPPSSPPPPKPDMTTTTEDTRKDN
KSPNNTVLIVAISIVIALVIISAVLVYLYLKKKKASITIDDDMDDITRIESLRFDLDAIK
AATGNFSNANKLGRGGFGFVYKGMLSNGQEIAVKRLSINSGQGRKEFKTEVGLLVKLQHR
NLVKLLGFCLEEEEKLLIYEFVPNGSLDHHIFDPVKATNLNWETRYKIIGGIAKGLLYLH
EDSRLRIIHRDLKAANVLLDEENNAKISDFGMAKLFELDQTQGNSSKAVGTYGYIAPEYA
LHGQFSTKSDVYSFGVLLLEIVTGKRINQFYESDSSEYLLTYVWRHWEAGTALKLVDQTL
RENYSENEVKKCIQVGLLPVQDVTERPTMAKVAQMLANDATIPHSLPRPAVFSHGSIELK
RIPESGASSSATKSDRSSQFTDHSII
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccttcctatattttaatcatcttcatccatcaaaaacctgcaaaaccaaaa
ataggttcttacattttccgattgatcagttctgcagtcattctcctgatacacgtgaat
aatgacaaagtcattgctcaacccacatatgaacgtcagtactactgtcaaggagataac
tacacaaatcccagccaatttcaggttaacctaaacaaagttctctcgtctctctcctct
aacatcacaacaaccaatagaaagtttttctacagcagcataggcgaaaacatggataaa
gtttatggtatcttactatgtagaggagatattacaagacaagaaacctgcaagagttgt
gtggagattgcaatttcagagttggccgtacgttgtccaaacacgaaagagtatgttacc
tggtacactcactgtatgttaagatactcggacaaaaatatattctatgttatggagaca
gagccagaactgactttcaacagcgaaagtaatctcaccaaccagatggaatttaaggat
atagtaatacagttgatgcaaggtctagtgagaaacgctactacaaatgctaaccacgat
gggactttattttttgccactggttcttcaacagatacagtttatggcttggtacaatgt
actacagatatatctacaaccgactgcagcgattgtctaatgggtgcagttagtgatatc
gatctttgtcattatgggaagagaagcgggttagttcttagacctagttgtaatataagg
tatgattcgtatcctttctatgaatccaaacaagcaactaattcagggtcccctccctca
agtcctcctcctccaaaaccagatatgactacaaccacagaagatactagaaaagacaat
aagtcccccaacaatacagttcttattgtggccatttctatagttattgcacttgtaatc
atctctgcggtattagtatacttatatctaaagaagaagaaagcgtccatcacgattgat
gatgatatggatgacattacaaggatagagtcactgcggtttgacttggacgcaataaaa
gctgctactggaaatttctctaatgctaataagcttgggagaggaggatttggttttgtt
tacaagggtatgttatccaatggacaagaaatagctgtaaagaggctatctattaactct
ggacagggtagaaaagaatttaagactgaggttggtttactggtcaagcttcaacaccgg
aatcttgttaaactcctagggttctgcttggaggaagaagaaaagctacttatctatgag
tttgtgcccaatggaagccttgatcatcatatatttgaccccgtgaaagcaacaaatttg
aattgggaaacacgttacaaaattatcggagggatcgctaaaggcctactctatcttcat
gaagattctcgactaagaattattcatagagatctcaaagctgctaatgtgttgttagat
gaagagaataacgccaaaatatcagattttggtatggcaaagctgtttgaattggaccaa
actcaaggaaacagcagtaaggctgtgggaacatacggatacatagcaccagaatatgca
ttgcatgggcagttctcaacaaaatcagatgtatatagttttggtgtcttactactcgag
atagtaactggcaaaaggattaatcagttctatgaatcagacagctctgagtaccttcta
acctatgtatggagacattgggaagcaggaacagctttaaaattagtggaccaaacatta
agagagaactactcagaaaatgaagttaagaagtgcatacaggttgggttgttacccgtt
caagatgtaaccgagagaccaaccatggcgaaggttgctcaaatgctcgcgaatgatgct
accatcccccattcgttgccccgacctgcagtgtttagtcatggcagcatagaattaaaa
aggattccagagagtggcgcatcatcaagtgcaactaaatcagataggtcttcgcaattt
actgatcatagcatcatataa

DBGET integrated database retrieval system