KEGG   Papaver somniferum (opium poppy): 113349865Help
Entry
113349865         CDS       T05758                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00020  Citrate cycle (TCA cycle)
psom00640  Propanoate metabolism
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113349865
   00640 Propanoate metabolism
    113349865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psom04147]
    113349865
Enzymes [BR:psom01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     113349865
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     113349865
Exosome [BR:psom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113349865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 113349865
NCBI-ProteinID: XP_026449689
Position
2
AA seq 422 aa AA seqDB search
MVRGLLSKLVCRSLSVGGKSQQQQIRRLNIHEYQGAELMSKHGINVPKGVAVSSVEEVRK
AISDVFPKENELVVKSQILAGGRGLGTFKSGLKGGVHIVKTNEAEDIAGKMLGQVLVTKQ
TGAQGKTVSKVYLCEKMSLVNEMYFAITLDRTTAGPLIIACSKGGTSIEDLAEKFPDMII
KVPIDVFKGITDEDAAKVVDGLAPKVADKAASMEQVKKLYELFCKSDCTMLEINPIAETS
DNKLVAADAKLNFDDNAAFRQKEIFALRDTTQEDPREVAADKADLNYIGLDGEIGCMVNG
AGLAMSTMDIIKLHGGTPANFLDVGGSASEHQVVEAFKILTSDDKVKAILVNIFGGIMKC
DVIASGIVNAAKEVSLKVPVIVRLEGTNVDQGKRILKESGMTLITAEDLDDAAEKAVKAA
AS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggattacttagtaaactcgtttgtcgatctctttcagttgggggtaaatct
caacaacaacagattcgtcgtctcaatatccatgaatatcagggagcagagttgatgagt
aaacatggaattaatgtaccaaagggagtcgctgtttcatctgtcgaagaagttcgtaaa
gccatcagtgatgttttccccaaggaaaacgagttggttgttaaaagtcaaattctagct
ggtggtcgaggtttgggaacatttaagagtggtcttaaaggtggagttcacattgtgaag
acaaatgaggctgaggatatagctgggaagatgcttggacaagttctcgtcactaagcaa
actggtgcacaaggaaaaaccgtgagcaaggtttatttgtgtgaaaagatgtctctagtc
aacgagatgtacttcgccatcactcttgacaggacaactgctggtccacttattattgcc
tgtagcaagggagggaccagcattgaagaccttgctgagaaattccctgatatgataatc
aaggtgcccattgatgtcttcaaaggaataactgatgaagatgctgctaaagttgttgat
ggcttggcccccaaggttgcagataaggcggcttcaatggaacaagtgaagaagctctac
gagcttttttgcaaaagtgactgcaccatgctggagatcaaccccattgctgagacttct
gataacaaattggtagcagctgatgctaagttgaacttcgatgataatgctgctttccgc
cagaaagagatctttgctcttcgtgatacaacccaagaggaccctcgagaggtggctgct
gacaaagccgatttgaactacattggcttagatggggaaattgggtgcatggttaatggt
gctggattggcaatgtctaccatggacataattaagttgcatggtggaactcctgccaat
ttcttagatgtcggtggcagtgcctcagaacatcaggttgtggaagcatttaaaatattg
acatccgacgacaaggtgaaagcaatcttggtcaacatttttggaggaatcatgaagtgt
gatgttatagcaagtggtattgtcaatgctgccaaagaggtttcattgaaagttccagtt
attgttcgtcttgaaggaactaacgtcgatcaagggaagagaattttgaaggagagtggg
atgactcttattaccgcagaagatctggatgatgcagctgagaaagcagttaaagcagca
gccagttaa

DBGET integrated database retrieval system