KEGG   Papaver somniferum (opium poppy): 113355551Help
Entry
113355551         CDS       T05758                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00350  Tyrosine metabolism
psom01100  Metabolic pathways
Module
psom_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113355551
Enzymes [BR:psom01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     113355551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 113355551
NCBI-ProteinID: XP_026454220
Position
3
AA seq 225 aa AA seqDB search
MEATTTSTVIQQPPTLKLYSYFKSSCSFRVRFALHLKGLNYEYKAVNLLKGEQFSPEFLE
VNPIGYVPALVDGDLLVSDSFAILLYLEEKYPQHPLLPTNLQEKAVHYQAANIVGSGIQP
LQNLAILRYIGEKVGEDEKIPWVQQHIGKGFAALEKLLGGYAGKFATGDEIFLADLFIAP
QIHAAVTRFKIDMTQYPTLSRMYESYNELPAFHAALPENQPDSPK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaacaacaacatccactgtaatccaacaaccaccaacgctgaagctctattca
tacttcaagagctcttgttcttttcgtgttcgttttgcccttcatctgaaagggttgaat
tatgagtataaggcagtcaacctattgaaaggagaacagttcagtccagaatttctggag
gtgaatcctatcggttatgtgccggcactggtggatggggacttattagtttccgattct
tttgctatcttactgtacttggaagagaagtatcctcagcatccacttttgcctacgaac
cttcaggaaaaagccgtccattaccaagcggcgaatattgttggctcggggatacagcca
ttgcagaaccttgctatcctaagatatattggggaaaaagtcggtgaggacgagaagatt
ccttgggttcaacagcacataggaaaaggctttgcagcacttgagaagttactaggagga
tatgctggaaaattcgccacaggcgatgaaattttcctggcggatctgtttatagctccc
cagatacatgcagcggtcactcgtttcaaaattgacatgactcagtatcctactctatcc
aggatgtatgaatcatacaatgaattaccagcctttcatgctgctttgcctgagaaccaa
ccagattcccctaagtaa

DBGET integrated database retrieval system