KEGG   Papaver somniferum (opium poppy): 113357476Help
Entry
113357476         CDS       T05758                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260 isoform X1
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psom01003]
    113357476
Enzymes [BR:psom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     113357476
Glycosyltransferases [BR:psom01003]
 Polysaccharide
  Structural polysaccharide
   113357476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Syncollin Closter_coat
Motif
Other DBs
NCBI-GeneID: 113357476
NCBI-ProteinID: XP_026456664
Position
3
AA seq 453 aa AA seqDB search
MADLRNYKTSLIVSACLLLLLLSMYLCPYNNNRYFIANTDLFSIPPLSASSSSTIGEDNG
ILTQKKLTSLGRIEDDLARARAAIRTAARTRNYTSNKVQGFVPRGPIFRNPYAFHQSYIE
MERTFKIWTYKEGEPPLMHDGPHSTLYSIEGQFISEMERDKNPFAARNPDEAHAFFLPFS
VVNMGVVRETSDHFGPYIRVIADYATVVSNKYQYWNRSCGGDHFMVSCHDWAPYVTNATP
NKLFKNVIRVLCNANSSESFQPKRDVSMPEIYLLPRTLGTATQFRKIGLNRPILGFFAGG
AHGDIRKMLIRHWKDKDNDLQVHEYLPKGQNYGDLMARSKFCLCPSGYEVASPRVVEAIH
GSCVPVIISDHYVLPFSDVLDWSQFSIQIPVDKIPELKTILLAISNEKYLRLQKNVRLVK
RHFIINRPAQQFDVFNMILHSVWLRRLNFRLPA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcagacttgaggaattacaaaacaagtttgatagtttctgcttgtttgctacttctt
cttcttagcatgtacctatgtccctataataacaatcgatatttcatcgcaaacactgat
ttgttttctatacctcctttatcagcttcaagtagtagtactattggtgaagataacgga
attcttacgcagaagaaacttactagtttgggaagaatagaagatgatcttgcacgagct
agggcggctattcgaacggcggctcgaacacgtaattatacatctaacaaagtgcaaggt
ttcgttcctagaggaccaatcttcagaaatccatacgcctttcaccagagctatatcgag
atggagaggacattcaaaatttggacgtacaaggaaggtgaaccacctttgatgcatgat
gggccgcacagcaccctctattcaatagaaggccagtttattagcgaaatggagagggat
aaaaacccatttgcagcgcgaaaccccgatgaagctcacgcatttttccttcccttcagt
gtagtcaatatgggagttgtacgcgaaacttcggatcattttggtccttacattcgtgtc
attgcagattatgctactgttgtatcaaacaaataccagtactggaatagaagttgcggc
ggtgatcattttatggtttcctgtcatgactgggcaccttatgtaacaaatgcaaccccg
aataaactattcaagaacgtcattagggtactctgcaatgctaattcgtcagaaagcttt
caacctaaaagagatgtgtccatgccggaaatctaccttcttcctagaactcttggcacc
gcgacacagttccgtaaaatcggtttaaatcgtccgatacttgggtttttcgctggtggg
gctcatggagacataagaaagatgttaattaggcactggaaagacaaagacaatgattta
caagttcatgaatatcttcccaagggacaaaattacggtgaccttatggctcgaagcaaa
ttttgcttgtgccctagcgggtacgaagttgcaagtcctagagttgttgaggcaatccat
ggaagttgtgttcctgtgattatttcggatcattatgttctcccctttagtgacgtactt
gattggagtcagttttcgatacagattccggtagataaaataccagagctgaaaactata
ttactagcgatatccaatgagaagtaccttagacttcagaagaatgttaggctagtaaaa
agacattttattatcaatcgtcctgcccaacagtttgatgttttcaacatgatacttcat
tccgtttggttaaggcgtctaaattttcgtttacctgcttaa

DBGET integrated database retrieval system