KEGG   Papaver somniferum (opium poppy): 113359259Help
Entry
113359259         CDS       T05758                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
psom  Papaver somniferum (opium poppy)
Brite
KEGG Orthology (KO) [BR:psom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psom01001]
    113359259
Enzymes [BR:psom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113359259
Protein kinases [BR:psom01001]
 Serine/threonine kinases: TKL group
  IRAK family
   113359259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr Bact_lectin APH
Motif
Other DBs
NCBI-GeneID: 113359259
NCBI-ProteinID: XP_026458709
Position
3
AA seq 750 aa AA seqDB search
MCQDSETRMLEMQAYGCISSTGFLPKHLEEWRGFTTNPVQLLEQGIECQSVNSVMVNSTK
VLFSIKLISNLTGTLLRVSSVDPLRTELVNALSSNSSQTMLMLLTFSIFLNQASVSAFDP
ISFSFPSFNSNSCDEGGDLICSGSVVAGDGYLDITPRALDNGSLNSVPTNTVGRVLYKYP
VLAWPAGFSTTFDVRISTNPNATGFGEGMTFIMAPDSSPSPANSHGSFLGFLNRSTEGTT
VQQLAVELDTFQNNEFDPDDNHVGIDTVSIKSVVTSSLNNIGVNLKSGRWVKVKIDYDGW
GEKLQISVAYAGSLLVSVLSLSIKMSKTVPNWVYVGFTGSTGLVLESHQILNWVFTSVPL
PNYPTIHDPNSNHKIKDILVIIFPVLTGVLLLAICTYGVVKTCRPKCVDNSKEEDIESRS
RVAANGPKIFSFKELSKATNNFSKENLVGTGGFGSVYRGIISDSHSTVAVKKISAASKQG
EREYLAEICTIGRLRHRNLVQLLGWCHEHHQLLLVYEFMPNGSLDRFICNGSLDWHTRYK
ILTGLASALLYLHKECGNAVVHRDVKPNNVMLDSEYNPHLGDFGLARLLPDEASLTTNVA
GTLGYLAPECGYTGKATVECDVFSFEIVVLEVLCGRRCISTMEEKSLVDHVWGLHGKGEL
LQCVDPKLKNNFNQDEMLTALSIGLACSHPDPSSRPNVRKVVQLFRNPNEPLMDLPKFRS
NSGYLPSNSVSSVSTTNLLGLSSHPVWQVM
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaagattcagaaaccagaatgcttgagatgcaagcttatggttgcatcagcagt
acaggtttccttccaaagcacttggaagaatggcgaggatttactacaaatcctgtacaa
ttgttggagcagggcattgagtgccagtctgtcaattctgtcatggtgaatagcacaaag
gttcttttcagtataaagctcatatcgaaccttacaggaactttgctaagagtatcaagc
gttgatccactcagaacagagttagttaacgccttgagttcaaattcttctcaaaccatg
ttgatgcttttaacattctctatctttctaaatcaagcatctgtaagcgcttttgatcct
ataagtttctctttcccgtcttttaattctaatagttgtgatgaaggtggagacctcatc
tgttcaggttctgttgtggctggtgatggatatttggatatcaccccaagggctctagat
aatggcagcttaaattccgtgccaacaaatactgttggtcgtgttctgtataagtatcct
gttcttgcctggccggcaggtttctccactacctttgatgttaggatatcgacgaaccca
aatgcaacaggtttcggtgagggaatgacatttatcatggcacctgacagtagtccttcg
ccagccaacagccatgggtcgtttttaggtttcctcaatcgaagtactgaaggtaccaca
gttcagcaactagctgtggagttggacactttccagaacaatgagtttgaccctgacgac
aaccatgttgggatagacacagtgagcataaaatctgttgtgacatccagtctcaacaac
attggtgtgaatctcaaaagtggaagatgggtaaaggttaagatcgactatgatgggtgg
ggggagaaactccaaatttcagtggcatatgctggctcccttctagtgtctgttctcagt
ctttcaattaaaatgtcaaaaacagttccaaattgggtttatgtgggatttacaggctcc
actgggcttgtgttagagtcgcatcagattcttaactgggttttcacttcggtcccatta
ccaaattatcctacaattcatgatcctaacagcaatcacaagataaaagatattcttgta
ataatctttcctgtcctgactggtgtgttgctgttggccatatgcacgtatggagtggta
aaaacttgccggccaaaatgcgtggataactcaaaggaagaagacatcgagagtaggtct
cgggttgctgcgaatggccccaagatttttagttttaaggaactgtcaaaggccacaaat
aacttcagcaaagagaacttagtggggactggaggctttgggagtgtttatcgtggcatc
atatcggactcgcactccaccgtagctgtcaagaagatatcagcagcttcaaaacaaggt
gagcgggagtatttggcggagatatgcactattggacgcctaaggcacagaaacctcgta
caacttctaggttggtgtcatgaacatcatcaactcctccttgtctacgagttcatgcct
aacggtagccttgatcgcttcatatgcaatggctccctggactggcacactagatacaag
atcttaacagggttggcatcagcattattgtatctccacaaagagtgtggtaatgctgtt
gttcatcgcgatgttaagccgaacaatgtgatgttagattctgagtataatccccatttg
ggtgactttgggttagcaagattactcccagatgaagcttcattgacaacaaatgttgct
ggcactcttggatatttagcaccagaatgtggttatactggcaaagcaacagtagaatgt
gatgtcttcagcttcgaaattgtcgtacttgaagttttgtgtggaaggagatgtatcagt
acaatggaggaaaaaagcttagtcgatcatgtttggggtctccatggaaaaggtgaattg
ctgcagtgtgtggatccaaagcttaaaaacaacttcaatcaagatgaaatgttaactgct
ttatctattggcctcgcgtgttcacatccagatccatcttcacggcctaatgttcgtaaa
gttgttcagcttttcaggaacccaaatgaacctctgatggatttgccaaagtttagatct
aactctggttatctacctagcaactctgtctcttctgtctctacaacaaaccttttgggg
ttaagcagtcatccagtatggcaggtgatgtaa

DBGET integrated database retrieval system