KEGG   Papaver somniferum (opium poppy): 113361000Help
Entry
113361000         CDS       T05758                                 

Definition
(RefSeq) 8-amino-7-oxononanoate synthase-like isoform X1
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00780  Biotin metabolism
psom01100  Metabolic pathways
Module
psom_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    113361000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psom01007]
    113361000
Enzymes [BR:psom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     113361000
Amino acid related enzymes [BR:psom01007]
 Aminotransferase (transaminase)
  Class II
   113361000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DUF2325 Beta_elim_lyase Phage_holin_3_5
Motif
Other DBs
NCBI-GeneID: 113361000
NCBI-ProteinID: XP_026460181
Position
3
AA seq 346 aa AA seqDB search
MGPRGSALICVYTSHHRLLESCLADLKKKEDCLLCPTGFAANMALMVALGSVGSLLPDGK
KPLKNEKVVIFSDALNHASIIDGIRLADRQQVQIYVYKHCDMVHLNTLLSSCTLQKKVVV
SDGLFSMDGDFAPIKELAELRKKHGFLLVIDDAHGTLVCGKNGGGVAEEFNCESDVDICV
GTLSKAAGCQGGFIACSKKWKQLLQSRGRSFIFSTALPVPIAAAAHAAIVVGKKEKWRRK
AIWRRVQDFQALTKIPITSPIISLVVGSEENALIASKHILESGFHVTAIRPPTVPANSCR
LRVTLSAAHTIDDLLKLTTALSLCIKFKDIGVVTNFYKADGYYAKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaagaggttcagctttgatttgtgtgtataccagtcaccatagattactcgag
tcatgcttggcggatctcaagaagaaagaggattgtcttctctgtcctactggctttgca
gctaatatggctttgatggtagcactaggaagtgttggttcactcctacccgatggcaaa
aaaccattaaagaatgagaaggttgttattttctctgatgctctgaaccatgcatcaatc
attgacggtattcgcctcgctgaccgacaacaagttcagatctatgtttataaacactgt
gacatggtccacctaaatactttgttatcaagttgcacactgcagaaaaaagtcgttgtc
agcgatgggttgttcagtatggatggagattttgcaccaattaaagagcttgcggagctt
cgaaagaaacatggctttttgttggtcatcgatgatgctcatggaacacttgtttgtgga
aagaatggtgggggagttgcagaggagttcaactgtgaaagtgatgtggatatatgcgta
gggaccttgagtaaggctgccggatgccaaggtggattcatcgcttgcagcaaaaagtgg
aagcagctcttacaatccagaggccgttctttcatattttcaactgctttgccagtgcct
attgctgctgctgcacacgctgctattgttgtgggaaaaaaggagaagtggcggagaaaa
gcaatttggagaagggtacaagattttcaagctctcaccaagatacccattaccagtcca
atcatttctctcgttgttggaagtgaagaaaatgctcttattgcgagtaagcatattctg
gaatctggtttccacgtgacagccatcagacctccaacagtgcctgctaactcatgcagg
ttacgagtaactcttagcgcagcgcacactatagacgatctgctaaagctgacaactgct
ctctccctatgcatcaagttcaaagacattggtgttgtcacaaacttctataaagcagat
gggtactatgcaaagctgtag

DBGET integrated database retrieval system