KEGG   Papaver somniferum (opium poppy): 26895709Help
Entry
26895709          CDS       T05758                                 

Gene name
rbcL, AZ395_gp059
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom00630  Glyoxylate and dicarboxylate metabolism
psom00710  Carbon fixation in photosynthetic organisms
psom01100  Metabolic pathways
psom01110  Biosynthesis of secondary metabolites
psom01200  Carbon metabolism
Module
psom_M00165  Reductive pentose phosphate cycle (Calvin cycle)
psom_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
psom_M00532  Photorespiration
psom_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:psom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    26895709 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    26895709 (rbcL)
Enzymes [BR:psom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     26895709 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 26895709
NCBI-ProteinID: YP_009234990
UniProt: A0A125R3C5
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKAGVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEDNQYICYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREITLGFVDLLRDDYIEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLARQGNDIIREACKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaggtgttggattcaaagctggtgttaaagattac
aaattgacttattatactcctgactatgaaaccaaggatactgatatcttggcagcattc
cgagttactcctcaacctggagttccacctgaggaagcaggggccgcggtagctgccgaa
tcttctactggtacatggacaactgtgtggaccgatggacttaccagccttgatcgttac
aaaggaagatgctacgacatcgagcccgttgctggagaagacaatcaatatatttgttat
gtagcttatcctttagacctttttgaagaaggttctgttactaacatgtttacttccatc
gtgggtaatgtatttgggttcaaagcgcttcgtgctctacgtctggaggatctgcgaatt
cctgttgcttatgttaaaactttccaaggaccacctcacggtatccaagttgaaagagat
aaattgaataagtatggtcgtcccctattgggatgtactattaaaccaaaattggggtta
tctgctaagaactacggtagggcggtttatgaatgtctacgtggtggacttgattttacc
aaggatgatgaaaacgtgaactcacaaccctttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaatcacaggccgaaacaggtgaaatcaaaggacattacttg
aatgctactgcaggtacatgcgaagaaatgatgaaaagggctgtatttgccagagaattg
ggagttcctattgtaatgcatgactacttaacgggtggattcactgcaaatactagcttg
gctcattattgccgagataatggcttacttcttcacatccaccgcgcaatgcatgcagtt
attgatagacagaagaatcatggtatccacttccgtgtactagcgaaagcattacgtatg
tctggtggagatcatattcactctggtaccgtagtaggtaaactggaaggggaaagagaa
ataaccttgggctttgttgatttactacgtgatgattatattgaaaaagaccgaagtcgt
ggtatttatttcacccaagattgggtatctctaccgggtgttctgcctgtggcttcaggt
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgactctgtacta
cagttcggtggaggaactttaggacacccttggggtaatgcaccgggtgctgtagcaaat
cgagtagccctagaagcgtgtgtacaagcgcgtaatgagggacgtgatcttgctcgtcaa
ggtaatgacattatccgtgaagcttgcaaatggagccctgagctagcagctgcttgtgaa
gtatggaaggaaatcaaattcgaatttgaagcaatggatactttgtaa

DBGET integrated database retrieval system