KEGG   Paeniclostridium sordellii: RSJ16_16835Help
Entry
RSJ16_16835       CDS       T05252                                 

Definition
(GenBank) AAA family ATPase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psor  Paeniclostridium sordellii
Pathway
psor03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RSJ16_16835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psor03400]
    RSJ16_16835
Enzymes [BR:psor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RSJ16_16835
DNA repair and recombination proteins [BR:psor03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RSJ16_16835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 SH3_13 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD PIF1 T2SSE HHH_2 HHH_3 DUF2075 AAA_28 AAA AAA_22 ABC_tran SRP54 UvrD_C DEAD TrwB_AAD_bind PhoH DNA_pol_lambd_f KTI12 AAA_12 AAA_24 AAA_14 RsgA_GTPase Thymidylate_kin MMR_HSR1 NTPase_1 AAA_5 Zeta_toxin TK cobW DUF853 AAA_16 FtsK_SpoIIIE ResIII
Motif
Other DBs
NCBI-ProteinID: AUN15808
Position
complement(3417778..3420006)
Genome map
AA seq 742 aa AA seqDB search
MEKIEGMISDIVFKNEDNGYVIAHLSNENNDVVIVGCMPTLTVGESIEVEGKWVNHKTYG
TQFEVSSFMPVTPSSIEGIYVYLSSGMIKGIGEKMAKRIIDKFGVDTLDIIQNSPHRLSE
VEGIGSKKIEQIAKSYEDNRELRNIIMQLSPYGITPNLCLKIYKKYKNKAVDVISRNPYK
LAEDVRGIGFKVADKIAENLGIDKLSKDRIMQGILYSLNQSLASGHTYLPKDILVQESSK
LLGVEKEYILDCILGLAYDQKIHIEKGLGHEDHIYLIPYYLSENGVCKQIIKLAQSDFKD
LNIDVEKEIEKVEEETGIKLANNQALAVKEAIKSGLVVITGGPGTGKTTTINTIIKVFEN
NEQEVLLAAPTGRAAKRMSETSNKEAKTIHRLLEMGYATDSEELVFLKDEEDPIKADVVI
VDEVSMVDIVLMYSLLKAIKPGTRVILVGDSDQLPSVGAGNVLKDIIDSEVINVVRLNEI
FRQAQESMIVVNAHRINQGLPLHLNVKGKDFFFIKKDTNEEILKEIVGLVSTRLPKFYNL
DKLKDIQVLAPMRKGDLGVVNLNIELQKYLNKEEKYKVEETLQKRIFRVGDKVMQIKNNY
TKKWETEDKSESGEGIYNGDIGYIYHIDKENKIIYVLFDQTKIVSYEYSELDELDHSFCT
TIHKSQGSEFPAIVIPVTWAPPMLLNRNLLYTAVTRAKKLVVLVGDVKYLEYMIRNNKTN
DRHSNLSKKLNRLKEEGVLVKN
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatagaaggaatgataagcgatattgtatttaaaaatgaagataatggatat
gttatagctcatttatcaaatgaaaataatgatgttgtaattgttggatgtatgcctact
ttaacagttggggagagcatagaagtagaaggtaagtgggtaaatcataagacatatggg
actcaatttgaagttagtagttttatgccagtaactccatcttctatagaaggtatatat
gtttatctatcttctggaatgataaagggaataggcgagaagatggctaaacgaataatt
gataaatttggagttgacacactagatataattcaaaattctcctcatagactatctgaa
gtcgaaggaatcggaagtaaaaaaatagagcagattgctaaaagttatgaagataataga
gagttgagaaatataataatgcagttatctccttatggtataactcctaacttatgctta
aaaatttataaaaaatataaaaataaagctgtagatgttataagtagaaatccatataaa
ttagcagaagacgtaagaggaattggatttaaagttgcagataaaattgcagaaaattta
ggaatagataagctttcaaaagatagaataatgcaaggaatattatattctcttaatcag
tcattggctagcggacatacttatcttccaaaggatattttagtacaagagtcaagtaaa
cttttaggagtagaaaaagaatatatattagactgcattttagggttagcttacgatcaa
aaaatacatatagaaaaaggtttgggacatgaagatcatatatatttaataccatattac
ttatcagaaaatggagtttgtaagcaaatcataaaattagcacaatcagattttaaagat
ttaaatatagatgtagaaaaagaaatagaaaaagtagaagaagagacaggaataaaatta
gcaaataatcaagctttggcagttaaagaagctataaaaagtggtttagtagttataact
ggagggcctggtactgggaaaacaacaacaataaataccataattaaagtatttgagaac
aacgaacaagaagttttacttgcagccccaacgggaagggcggctaagagaatgagtgag
acatctaataaagaagcaaaaactattcatagacttttggaaatgggatatgctacagac
tcagaagagttggtatttctaaaagatgaagaagatccaataaaagctgacgtagttata
gtggatgaggtatcaatggtggatatagtccttatgtatagtttattaaaagctataaaa
cctggaactagggttatattagttggtgatagtgatcagcttccatctgtaggggcagga
aatgttttaaaagatataatagattcagaagttataaatgttgttagattaaatgaaatt
tttaggcaagctcaagagagtatgatagtagtaaatgcacataggattaatcaaggctta
ccacttcacttaaatgttaaaggcaaggatttcttttttataaaaaaagatactaatgaa
gaaattttaaaagaaatagttggattagtgagtactagactacctaaattctataattta
gataaattaaaagatatacaggtattagctcctatgagaaagggagatttaggtgtagtt
aatctaaatattgaattacaaaagtatttgaataaggaagaaaagtataaggttgaagag
acattacaaaaaaggatatttagagttggcgataaagtaatgcaaataaaaaataactat
actaaaaagtgggaaacagaagataaaagtgaaagtggagaaggtatatacaatggagat
ataggctatatttatcatatagataaggaaaataaaattatttatgtattgtttgatcaa
acaaagatagtatcatatgagtattcagaattagatgaactggaccatagtttttgtaca
actatacataagagccaaggaagtgaatttccagctatagttatacctgtaacgtgggct
ccacctatgttattaaatcgtaacttactatatacagctgtaacaagagcgaaaaaactt
gttgtgctagtaggggatgtaaaatatctagaatacatgataagaaataataaaactaat
gacaggcattctaatttaagtaaaaagctaaatagattaaaggaagaaggggtgttggta
aaaaattaa

DBGET integrated database retrieval system