KEGG   Pseudomonas sp. Os17: POS17_1740Help
Entry
POS17_1740        CDS       T04177                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00020  Citrate cycle (TCA cycle)
psos00310  Lysine degradation
psos00380  Tryptophan metabolism
psos01100  Metabolic pathways
psos01110  Biosynthesis of secondary metabolites
psos01120  Microbial metabolism in diverse environments
psos01130  Biosynthesis of antibiotics
psos01200  Carbon metabolism
Module
psos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    POS17_1740
  09105 Amino acid metabolism
   00310 Lysine degradation
    POS17_1740
   00380 Tryptophan metabolism
    POS17_1740
Enzymes [BR:psos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     POS17_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAQ73434
UniProt: A0A0D6BFB6
Position
1907652..1908872
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGEAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KNEGDTVLSDEVLGSIVEGGAATAAPAAAAPAAAAAAPAAADGEDDPIAAPAARKLAEEN
GINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKAPAPAAAAPVFAAGDRVEKRVP
MTRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGSDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIEGGI
ATFGKKARDGKLSMEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAIN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcaaccgggcgaagccgtcaagcgcgacgagctgatcgtcgacatcgag
accgacaaggttgtgctggaagttctggccaccgctgacggcgtgctgggcgctatcgtc
aagaacgaaggcgacaccgttctgtccgacgaagttctgggctccatcgttgaaggcggt
gccgctaccgctgctcctgctgccgctgctccggccgctgccgctgctgccccggctgcc
gctgacggcgaagacgatccaatcgccgctcctgccgcgcgcaagctggctgaagaaaac
ggcatcaacatcgcttccgttgccggtaccggcaaaggtggtcgtgtgaccaaggaagac
gtagtggctgccgttgccgccaagaaagccgctccggctgccgcgcctgccaaggctccg
gccccggctgccgctgctccggtgttcgctgccggtgatcgcgtcgagaagcgcgtacca
atgacccgtctgcgtgccaaggttgccgagcgtctggttgaagcccagtcgaacatggcg
atgctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaagtac
aaggacctgttcgagaagtcccacaacggcgtgcgcctgggcttcatgtcgttcttcgtc
aaggccgccaccgaagcgctgaaacgcttccctgcggtcaacgcctcgatcgacggttcc
gacatcgtttaccacggctacgccgacatcggtgttgcggtctccagcgaccgtggcctg
gtggttccggttctgcgtaatgccgagctgatgagcctggccgaaatcgaaggcggcatc
gccaccttcggcaagaaggctcgcgacggcaagctgtcgatggaagaaatgaccggtggt
actttcaccatcaccaacggtggtactttcggctcgatgatgtcgaccccgatcgtcaac
ccaccgcaagccgctatcctgggcatgcacaacatcctgcaacgtcctatggcgatcaac
ggtcaggtagtaatccgtccgatgatgtacctggcgctgtcctacgatcaccgtctgatc
gacggtaaagaagctgtgacattcttggtaaccatcaagaacctgctggaagacccggcg
cgtctgcttctggacatctaa

DBGET integrated database retrieval system