KEGG   Pseudomonas sp. Os17: POS17_2305Help
Entry
POS17_2305        CDS       T04177                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00071  Fatty acid degradation
psos00072  Synthesis and degradation of ketone bodies
psos00280  Valine, leucine and isoleucine degradation
psos00310  Lysine degradation
psos00362  Benzoate degradation
psos00380  Tryptophan metabolism
psos00620  Pyruvate metabolism
psos00630  Glyoxylate and dicarboxylate metabolism
psos00640  Propanoate metabolism
psos00650  Butanoate metabolism
psos00900  Terpenoid backbone biosynthesis
psos01100  Metabolic pathways
psos01110  Biosynthesis of secondary metabolites
psos01120  Microbial metabolism in diverse environments
psos01130  Biosynthesis of antibiotics
psos01200  Carbon metabolism
psos01212  Fatty acid metabolism
psos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psos00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    POS17_2305
   00630 Glyoxylate and dicarboxylate metabolism
    POS17_2305
   00640 Propanoate metabolism
    POS17_2305
   00650 Butanoate metabolism
    POS17_2305
  Lipid metabolism
   00071 Fatty acid degradation
    POS17_2305
   00072 Synthesis and degradation of ketone bodies
    POS17_2305
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    POS17_2305
   00310 Lysine degradation
    POS17_2305
   00380 Tryptophan metabolism
    POS17_2305
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    POS17_2305
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    POS17_2305
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    POS17_2305
Enzymes [BR:psos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     POS17_2305
Exosome [BR:psos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   POS17_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAQ73999
UniProt: A0A0D6BGW3
Position
complement(2534840..2536018)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAVDLGAAVIRQLLAQTGIDPAQVDEVIMGQVLTAG
AGQNPARQAAIKAGLPHAVPAMTLNKVCGSGLKALHLAAQAIRCGDAEVMIAGGQENMSL
SNYVLPGARTGLRMGHSPMIDTMISDGLWDAFNDYHMGITAENLVDKYAISREAQDAFAA
ASQQKAVAAIEAGRFVDEITPILIPQRKGEPLSFATDEQPRPGTTAEALAKLKPAFKKDG
TVTAGNASSLNDGAAAVLLMSASKARALGLPVLARIAAYANAGVDPAIMGIGPVSATRRC
LDKAGWTLDQLDLIEANEAFAAQSLSVGKELEWDASKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMLKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgttgccgccacccgtaccgccgtgggcagtttccagggctcc
ctggcgggcattcccgccgttgacctgggcgccgcggtgatccgccagctgctggcccag
accggcatcgacccggcccaggtcgacgaagtgatcatgggccaggtgctcaccgccggc
gccgggcagaaccccgcgcgccaggccgcgatcaaggccggcctgccccacgccgtgccc
gccatgaccctgaacaaggtctgcggctcgggcctcaaggccctgcacctggccgcccag
gccatccgctgcggcgatgccgaggtgatgatcgccggcggccaggaaaacatgagcctg
tccaactacgtgctgcccggcgcccgcaccggcctgcgcatgggccacagcccgatgatc
gataccatgatcagcgacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaaatacgccatcagccgtgaagcccaggacgccttcgccgcc
gcgtcccagcaaaaagccgtggccgccatcgaggccgggcgttttgtcgacgagatcacc
ccgatcctgattccccagcgcaagggcgagccgctgagcttcgccaccgacgaacaaccg
cgccccggcaccaccgccgaggccctggccaagctcaagccggcgttcaagaaagacggc
acggtgaccgccggcaacgcctcgtcgctgaacgatggcgccgccgcagtgctgctgatg
agcgccagcaaggctcgcgccctgggcctgccggtactggcccggatcgccgcctacgcc
aacgccggggtcgacccggcgatcatgggcatcggcccggtgtcggccacccgccgctgc
ctggacaaggccggctggaccctggaccagctggacctgatcgaagccaacgaagccttc
gccgcgcaatcgctgtcggtcggcaaggagctggaatgggatgcgagcaaggtcaacgtc
aacggcggcgcgattgccatcggccacccgattggcgcgtcgggctgccgggtgctggtg
accctgctgcatgaaatgctcaagcgcgatgccaagaaaggcctggcgaccctgtgcatc
ggcggcggccagggcgtggcactggccatcgaacgctaa

DBGET integrated database retrieval system