KEGG   Pseudomonas sp. Os17: POS17_3064Help
Entry
POS17_3064        CDS       T04177                                 

Gene name
hisQ
Definition
(GenBank) histidine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
psos  Pseudomonas sp. Os17
Pathway
psos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    POS17_3064 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psos02000]
    POS17_3064 (hisQ)
Transporters [BR:psos02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    POS17_3064 (hisQ)
   Histidine transporter
    POS17_3064 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Holin_9
Motif
Other DBs
NCBI-ProteinID: BAQ74758
UniProt: A0A0D6BHY4
Position
complement(3471042..3471767)
Genome map
AA seq 241 aa AA seqDB search
MNTSTTLFGLDLTVLQGYGPLLLHGTWVTLKLSALALLVSMALGLLGAAAKLSPLRLLNL
PATCYTTLIRGVPDLVLMLLIFYSLQGWLTALTELLDWPYMEIDPFVAGIITLGFIYGAY
FTETFRGAMLSVPRGQQEAAAAFGLGRWQRFRFVVFPQMMRYALPSLGNNWLVLLKATAL
VSIIGLSDLVKVAQEAGKSTFNMLDFLLLAAALYLLITSASNQLLRLLERRYNQGVRGLS
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacctcgacgactctcttcggcctcgacctgacggtcctgcaaggctatggcccg
ctgttgctgcacggcacctgggtgaccctgaaactctcggccctggcgctgctggtgagc
atggccctgggccttttgggcgcggctgccaagctctcgcccctgcgcctgctgaacctg
ccggcgacctgctacaccaccctgattcgcggggtgccggacctggtgctgatgctgttg
atcttctacagcctgcaaggctggctcacggccctgaccgagctgctggactggccctac
atggaaatcgaccccttcgtggccgggatcatcaccctgggctttatctatggtgcctat
ttcaccgaaacctttcgcggggcgatgctcagcgtgccccggggccagcaggaggcggcg
gcggccttcggcctcggtcgctggcagcgctttcgtttcgtggtgttcccgcaaatgatg
cgctacgccttgcccagcctgggcaacaactggctggtgctgctcaaggccacggccctg
gtgtcgatcatcggtctttcggatctggtcaaggtggcccaggaggccggcaagagcacc
ttcaacatgctggacttcctgctcctggcggcggccctgtacctgctgatcaccagcgcc
tcgaaccagctgctgcgcctgctggaacggcgctacaaccaaggcgtgcgagggctgtcg
cgatga

DBGET integrated database retrieval system