KEGG   Pseudomonas sp. Os17: POS17_3330Help
Entry
POS17_3330        CDS       T04177                                 

Gene name
ghrB1
Definition
(GenBank) glyoxylate/hydroxypyruvate reductase B
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00030  Pentose phosphate pathway
psos00480  Glutathione metabolism
psos01100  Metabolic pathways
psos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    POS17_3330 (ghrB1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    POS17_3330 (ghrB1)
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     POS17_3330 (ghrB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: BAQ75024
UniProt: A0A0D6BJU8
Position
3785516..3786511
Genome map
AA seq 331 aa AA seqDB search
MKKHLVLYKKLSPSLMARLQEQTEVTLIEDLGPNGLKALRQALPSADGLLGASLRLDAEL
LDLAPRLQAVASVSVGVDNYDIDYLTQRGILLSNTPDVLTETTADTGFALILATARRVVE
LANLVRAGQWQRNIGPLHFGSDVHGKTLGIIGMGRIGEALAQRGHFGFGMPLIYHSNRPK
PAVEQRFNARYRSLEQLLQEADFICLTLPLTEKTQGLIGRRELALMRPESIFINISRGKV
VDEAALIEALQARRIRGAGLDVFEREPLDPDSPLLQLPNVVATPHMGSATHETREAMARC
AVDNLLAALSGQRPPNLVNSAAWSLGTRQTG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacctggtgctgtacaagaaactctcgccgtcgctgatggcgcgcctgcag
gaacagaccgaggtcaccctgatcgaggacctgggccccaacggcctcaaggccctgcgc
caggccctgcccagcgccgacgggttgctgggggccagcctgcgcctggacgccgaactg
ctggacctggcaccgcgcctgcaggcggtggccagcgtctcggtgggggtcgacaactac
gacatcgactacctgacccaacgtgggatcctgctcagcaacaccccggacgtgctcacc
gaaaccaccgccgacaccggcttcgcgctgatcctggccaccgcccggcgggtggtggaa
ctggccaacctggtgcgcgccgggcaatggcagcgcaacatcggtccgctgcatttcggc
agcgacgtgcacggcaagaccctgggcatcatcggcatgggccgcattggcgaggcgttg
gcccagcgcgggcatttcggcttcggcatgccgctgatctaccacagcaaccgccccaag
ccggcggtggaacaacgcttcaatgcccgctaccggagcctggagcaactgctgcaagag
gccgacttcatctgcctgaccctgcccttgaccgaaaagacccaggggctgattggccgc
cgcgaactggcgctgatgcgcccggagagcatcttcatcaatatttcccggggcaaggtg
gtggacgaagcggcgctgatcgaagccttgcaggcccggcggatccgcggcgccgggctg
gacgtgttcgagcgcgaaccgctggacccggactcaccgctgctgcaactgcccaacgtg
gtggccactccgcacatgggctcggccacccacgaaacccgcgaagccatggcccgctgc
gccgtggacaacctgctggcggccctgtccggccagcgcccgcccaacctggtcaatagc
gccgcgtggagcctcgggacacgacagaccggttaa

DBGET integrated database retrieval system