KEGG   Pseudomonas sp. Os17: POS17_3610Help
Entry
POS17_3610        CDS       T04177                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00071  Fatty acid degradation
psos00072  Synthesis and degradation of ketone bodies
psos00280  Valine, leucine and isoleucine degradation
psos00310  Lysine degradation
psos00362  Benzoate degradation
psos00380  Tryptophan metabolism
psos00620  Pyruvate metabolism
psos00630  Glyoxylate and dicarboxylate metabolism
psos00640  Propanoate metabolism
psos00650  Butanoate metabolism
psos00900  Terpenoid backbone biosynthesis
psos01100  Metabolic pathways
psos01110  Biosynthesis of secondary metabolites
psos01120  Microbial metabolism in diverse environments
psos01130  Biosynthesis of antibiotics
psos01200  Carbon metabolism
psos01212  Fatty acid metabolism
psos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    POS17_3610
   00630 Glyoxylate and dicarboxylate metabolism
    POS17_3610
   00640 Propanoate metabolism
    POS17_3610
   00650 Butanoate metabolism
    POS17_3610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    POS17_3610
   00072 Synthesis and degradation of ketone bodies
    POS17_3610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    POS17_3610
   00310 Lysine degradation
    POS17_3610
   00380 Tryptophan metabolism
    POS17_3610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    POS17_3610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    POS17_3610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    POS17_3610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psos04147]
    POS17_3610
Enzymes [BR:psos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     POS17_3610
Exosome [BR:psos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   POS17_3610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAQ75304
UniProt: A0A0D6BKQ2
Position
complement(4024390..4025631)
Genome map
AA seq 413 aa AA seqDB search
MNGAGQYSEFADVAILEALRTPWVDLGGDLAEISPIDLGIKVGREVLQRAGIDARAVDSV
LAGSMAQASFDAYLLPRHIGLYSGVGQAVPALGVQRICATGFELLRQAAEQLRGEVQLAL
CVASESMSRNPIAAYTHRGGFRLGAAVQFKDFLWEALYDPAPGLDMIATADNLARRYGLT
REAVDGYACASHQRALAAQQAGWFAPEIVAVSQQAFELDCYRPRGIRLPRGVETVSQDSH
PRPGELSALACLRTIHEGGVQTAGNSCAVVDGAAAALVGRASACITTPLALLLGSAVVGV
APECMGIGPAPAIRLLLQRSGLGLEQVGRLEINEAQAAQLLAVARELELDSERLNARGGS
LALGHPLAASGLRLVLTLARQLREHNLRYGIAAACVGGGQGMALLIENPAWRG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgccgggcagtacagcgagtttgccgatgtggcgatccttgaggcattgcgc
acgccctgggtcgaccttggcggggacctggcggagatctcgccgatcgatctggggatc
aaggtcggccgcgaggtactgcagcgcgccggcatcgatgcccgggcggtggacagcgtg
ctggccggctccatggcccaggccagtttcgacgcctacctgctgccccggcacatcggc
ctgtacagcggcgtcgggcaagcggtgccggccctgggggtgcagcgcatctgcgccacc
ggtttcgagctgttgcgccaggcggccgagcagctgcggggcgaggtgcaactggcgttg
tgcgtggccagtgaatcgatgtcgcgcaacccgattgccgcctacacccatcgcggcggc
tttcgcctgggggcggcggtgcagttcaaggacttcttatgggaggcgctgtacgacccg
gcgccggggctggacatgatcgccaccgctgacaacctggcgcggcgttatggcctgacc
cgcgaagccgtggacggctatgcctgcgccagccatcagcgggccctggcggcgcagcag
gcgggctggttcgcgccggaaatcgtcgccgtaagccagcaggccttcgagctcgactgc
tatcgaccgcgcggcattcgcctgccacggggtgtcgagacggtcagccaggacagtcat
ccgcgccctggtgagctgtctgccctggcgtgcttgcggacgatccacgagggcggggtg
cagaccgccggcaacagttgcgcggtggtcgatggcgcggcggcggccctggtcgggcgg
gcgtcggcctgcatcacgacgcccctggcgctgttgctgggcagtgcggtggtcggggtg
gcgccggagtgcatgggcatcggcccggctccggcaatccgcctgctcctgcagcgcagc
ggcctgggcctggaacaggtgggtcgccttgaaatcaacgaggctcaggcggcccagctg
ctggccgtggcccgggagctggagctggacagtgagcgcctgaatgcccggggcggttcc
ctggccctggggcaccccctggccgccagcggcctgcgcctggtgctgaccctggcccgg
caactgcgcgagcacaacctgcgctacgggatcgccgccgcctgcgtgggaggcggccag
ggcatggcgctgctgatcgaaaacccggcctggcgcggctga

DBGET integrated database retrieval system