KEGG   Pseudomonas sp. Os17: POS17_3717Help
Entry
POS17_3717        CDS       T04177                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00620  Pyruvate metabolism
psos00630  Glyoxylate and dicarboxylate metabolism
psos01100  Metabolic pathways
psos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    POS17_3717
   00630 Glyoxylate and dicarboxylate metabolism
    POS17_3717
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     POS17_3717
    1.2.1.22  lactaldehyde dehydrogenase
     POS17_3717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAQ75411
UniProt: A0A0D6BKC4
Position
complement(4158131..4159555)
Genome map
AA seq 474 aa AA seqDB search
MQLEQNFVNGDFIKPASGVSIAVYDPADESLVGHVSAATQEEAHAAVTAACAAQKKWAAL
TSIQRGDYLRALADALESRADAIGQALAAESGKSLADASNEARYAAQITRYHAEWARRIE
GEIIPSDSPDEKLFLHREAIGVVACLIPFNYPVYTLLRKVAPALIAGNTVVVRPSNNTPI
SAFEIARAVQQAGLPPGVVNILTMDHATAATVCTHPAVGMITLTGSVNAGRIVLDYCKAN
IAKPSLELGGKTPAIIEPDADLEQAASAIIASKTTHCGQLCTAVERVYVHESVHERFLAL
LKDKIAAVQFGDRRQDPGRMGPLVSAASREAIHGLVQRAVAQGAVLEAGGVMPEGPGHFY
PPTLLSACRQDMEIVQEEIFGPVLPVLKYRDIDEALALANDHQFGLASVLYTENYRTAMK
VAGAIQAGELYVNRTPADPYQGYHAGWKRSGLGGDDGKHGMLEFTQTRLVVMPF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttgaacagaattttgttaacggcgacttcatcaaacccgccagcggcgtatcc
atcgcggtctatgatccggccgacgaaagccttgtggggcatgtctcggccgccactcag
gaagaggcccatgctgcggtgactgccgcctgtgcggcgcagaaaaaatgggctgccttg
accagcatccagcgcggtgactatctgcgcgcattggccgatgccctggagtcgcgtgcc
gacgccattggccaggcgctggcggccgaatcgggcaaaagcctggcggacgccagcaat
gaagcccgttacgccgcgcagatcactcgttatcacgctgaatgggcgcgccgcatcgag
ggcgagatcattcccagcgacagccccgacgaaaagctgtttctgcaccgcgaggcgatt
ggcgtcgtggcttgcctgatcccgttcaactacccggtctacaccctgctgcgcaaggtg
gcgccggcgctgatcgccggcaacacggtggtggtgcgtccgagcaacaacacgccgatc
tcggcttttgaaatcgctcgggcggtccagcaggccggcctgccgcctggggtggtgaac
atcctgaccatggaccacgccaccgctgccaccgtctgtacccacccggcagtgggcatg
atcaccctgaccggcagcgtcaatgccgggcgtatcgtgctcgactactgcaaggccaat
atcgccaagccgtccctggaactgggcggcaagaccccggccatcatcgagcccgacgcc
gacctggagcaggccgccagcgccatcatcgcttccaagacgacccactgcggccagttg
tgcacggcagtggaacgggtctatgtccatgaaagcgtgcacgagcgattcctggccctg
ctcaaggacaagatcgccgccgtgcaattcggtgatcggcgccaggatccgggccgcatg
gggcctctggtgagtgcggcatcgcgggaggcgatccatggcctggtgcagcgggcggtc
gcccagggcgcggtgctcgaagccggtggcgtgatgcccgaggggccggggcatttctat
ccgccgacgctgctcagcgcgtgccgccaggacatggagatcgttcaggaggaaatcttc
gggccggtcctgccggtgctcaagtaccgggatatcgatgaagccctggccttggccaat
gaccaccagttcggcctggcctcggtgctctacaccgagaactaccgcaccgcgatgaaa
gtcgccggggccatccaggccggcgagttgtacgtcaaccgaaccccggctgacccctac
cagggctaccacgccggctggaagcgctcagggctgggcggtgacgacggcaagcacggc
atgctcgagttcacccagacccgcctggtggtcatgcctttctaa

DBGET integrated database retrieval system