KEGG   Pseudomonas sp. Os17: POS17_4677Help
Entry
POS17_4677        CDS       T04177                                 

Gene name
zwf-1
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00030  Pentose phosphate pathway
psos00480  Glutathione metabolism
psos01100  Metabolic pathways
psos01110  Biosynthesis of secondary metabolites
psos01120  Microbial metabolism in diverse environments
psos01200  Carbon metabolism
Module
psos_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psos_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
psos_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    POS17_4677 (zwf-1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    POS17_4677 (zwf-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psos04147]
    POS17_4677 (zwf-1)
Enzymes [BR:psos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     POS17_4677 (zwf-1)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     POS17_4677 (zwf-1)
Exosome [BR:psos04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   POS17_4677 (zwf-1)
  Exosomal proteins of colorectal cancer cells
   POS17_4677 (zwf-1)
  Exosomal proteins of bladder cancer cells
   POS17_4677 (zwf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAQ76371
UniProt: A0A0D6BN34
Position
complement(5256558..5258027)
Genome map
AA seq 489 aa AA seqDB search
MPSITVEPCTFALFGALGDLALRKLFPALYQLDAAGLLHDDTRILALAREPGSEQEHLAN
IETELRKYVGDKDIDAQVLKTFLARLSYLHVDFLKAEDYVALAERAGSEQRLIAYFATPA
AVYGAICENLSRVGLNQHTRVVLEKPIGSDLDSSRKVNDAVAQFFPENRIYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNYISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQ
LLCLIAMDPPADLSADSIRDEKVKVLKALAPISPEGLTTQVVRGQYIAGHSEGQSVPGYL
EEENSNTQSDTETFVALRADIRNWRWAGVPFYLRTGKRMPQKLSQIVIHFKEPSHYIFAP
EQRLQISNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTYRSARIPDAYE
RLLLEVMRGNQNLFVRKDEIEAAWKWCDQLIAGWKKSGDAPKPYAAGSWGPMSSIALITR
DGRSWYGDI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgattacggttgaaccctgcacctttgccttgttcggcgcgctgggcgatctg
gcgctgcgtaagctgtttcctgccttgtaccaactcgatgccgccggtctgctgcacgac
gacacgcggattctggccctggcccgtgagccgggcagcgaacaggagcacctggcgaac
atcgaaaccgagttgcgcaagtacgtcggcgacaaggacatcgatgcccaggttctcaag
accttcctggcccgcctgagctacctgcacgtggatttcctcaaggccgaggactacgtg
gcgctggccgaacgcgccggcagcgaacagcggctgatcgcctacttcgccactccggcc
gcggtctatggcgcgatctgcgagaacctgtcccgggtcgggctcaaccagcacacccgc
gtggtcctggaaaagcccatcggctcggacctggattcctcgcgcaaggtcaacgacgcg
gtggcccagttcttcccggaaaaccgcatctaccggatcgaccactacctgggcaaggag
acggtgcagaacctgatcgccctgcgtttcgccaacagcctgttcgaaacccagtggaac
cagaactacatctcccacgtggaaatcaccgtggccgagaaggtcggcatcgaaggccgt
tggggttacttcgacaaggccggccaactgcgggacatgatccagaaccacctgctgcag
ctgctgtgcctgatcgccatggacccaccggcggacctctccgccgacagcatccgtgac
gagaaggtcaaggtgctcaaggccctggcgccgatcagtccggaaggcctgaccacccag
gtggtgcgcggccagtacatcgccggccacagcgagggccagtcggtgccgggttatctg
gaggaagaaaactccaacacccagagcgacaccgaaaccttcgtcgccctgcgggccgat
atccgcaactggcgttgggccggggtgccgttctacctgcgcaccggcaagcgcatgccg
caaaaactgtcgcagatcgtcatccacttcaaggaaccgtcacactatatcttcgccccc
gagcagcgcctgcagatcagcaacaagctgatcatccgcctgcagccggacgaaggcatt
tcgctgcgggtgatgaccaaggagcagggcctggacaagggcatgcaactgcgcagcggt
ccgctgcaactgaatttttccgacacctatcgcagcgcgcggatccccgatgcctacgag
cggttgttgctggaagtgatgcgcggcaatcagaacctgtttgtccgcaaagatgaaatc
gaagccgcgtggaagtggtgtgaccagttgatcgccgggtggaagaagtccggtgatgcg
cccaagccgtacgcggccgggtcctgggggccgatgagctccattgcactgatcacgcgg
gatgggaggtcctggtatggcgatatctga

DBGET integrated database retrieval system