KEGG   Pseudomonas sp. Os17: POS17_4820Help
Entry
POS17_4820        CDS       T04177                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00450  Selenocompound metabolism
psos00970  Aminoacyl-tRNA biosynthesis
psos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    POS17_4820 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    POS17_4820 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psos01007]
    POS17_4820 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psos03016]
    POS17_4820 (metG)
Enzymes [BR:psos01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     POS17_4820 (metG)
Amino acid related enzymes [BR:psos01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   POS17_4820 (metG)
Transfer RNA biogenesis [BR:psos03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    POS17_4820 (metG)
 Prokaryotic type
   Other AARSs
    POS17_4820 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAQ76514
UniProt: A0A0D6BP43
Position
5411329..5413380
Genome map
AA seq 683 aa AA seqDB search
MSEPRKILVTSALPYANGSIHLGHMLEYIQTDMWVRFQKHRGNQCIYVCADDAHGSAIML
RAEKEGITPEQLIANVQAEHSADFADFLVDFDNFHSTHAEENRELSSQIYLKLRDAGHIA
TRSITQYFDPEKKMFLADRFIKGTCPKCGTEDQYGDNCEKCGATYAPTDLKDPKSAISGA
TPVLKDSQHFFFKLPDFQQMLQSWTRSGTLQDAVANKIAEWLDAGLQQWDISRDAPYFGF
EIPDEPGKYFYVWLDAPIGYMASFKNLCNRRPELDFDAFWGKDSTAELYHFIGKDIVNFH
ALFWPAMLEGAGYRKPSGINVHGYLTVNGQKMSKSRGTFIKARTYLEHLSPEYLRYYYAS
KLGRGVDDLDLNLEDFVQKVNSDLVGKVVNIASRCAGFIHKGNAGVMVDSNAAPELTEAF
LAAAPSIADAYEARDFARAMREIMALADRANAWIADKAPWSLNKQEGKQAEVQAICATGI
NLFRQLVIFLKPVLPLLAADAEAFLNVAPLTWNDHQHLLANHQLNEFKPLMTRIDPVKVQ
AMTDASKEDLTASQTDTGAAAPAGNGELAKDPLSPEIDFDTFAAVDLRVALIVKAEAVEG
ADKLLRLTLDIGDEQRNVFSGIKSAYPDPSKLDGRLTMMIANLKPRKMKFGISEGMVMAA
GPGGEEIYLLSPDSGAKPGQRIK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccacgcaagatcctcgtcaccagcgccctgccctatgccaatggttccatc
caccttggccacatgcttgagtacatccagaccgacatgtgggtgcgcttccagaagcat
cgcggcaaccaatgcatctatgtctgcgcggacgacgcacacggctcggccatcatgttg
cgcgcggaaaaggaaggcatcaccccggaacaactgatcgccaacgtccaggccgaacac
agcgccgactttgccgacttcctggtggacttcgacaacttccactcgacccacgccgag
gaaaaccgcgagctgtcgagccagatctacctcaagctgcgcgacgccgggcacatcgcc
acgcgctccatcacccagtatttcgacccggaaaagaaaatgttcctggccgaccgcttc
atcaagggcacctgcccgaaatgcggcactgaggaccagtacggcgacaactgcgaaaaa
tgcggcgccacctatgcccccaccgacctgaaggatccgaagtcggcgatctccggcgcc
actccggtgctcaaggattcccagcacttcttcttcaagctgccggacttccagcagatg
ctgcaaagctggacccgcagcggcaccctgcaggacgccgtggccaacaagatcgccgag
tggctggatgccggcctgcagcagtgggacatttcccgcgacgcgccgtacttcggcttc
gagatccccgacgagccgggcaaatacttctacgtgtggctggacgcaccaatcggctac
atggccagcttcaagaacctctgcaaccgtcgtccggagctggatttcgacgcgttctgg
ggcaaggattccaccgccgagctgtaccacttcatcggcaaggacatcgtcaacttccat
gccctgttctggcccgccatgcttgaaggcgccggctaccgcaagccgagtggcatcaac
gtccacggctacctgacggtcaatggccagaagatgtccaagtcccgcggcaccttcatc
aaggcccgcacctacctggagcacctgtcgccggaatacctgcgctactactacgcctcc
aagctgggccgtggcgtcgacgacctggacctgaacctcgaagacttcgtgcagaaggtc
aactccgacctggtgggcaaggtggtcaacatcgccagccgttgcgccggtttcatccac
aaaggcaatgccggggtgatggtcgacagcaatgccgcccccgagctgaccgaggccttc
ctggccgccgcaccaagcatcgccgacgcctatgaagcccgcgactttgcccgcgccatg
cgcgaaatcatggccctggccgaccgcgccaacgcctggatcgccgacaaggccccatgg
tcgctgaacaagcaggaaggcaagcaggccgaggtgcaggccatctgcgccaccggcatc
aacctgttccgccagttggtgatcttcctcaagccggtgctgccgctgctggccgccgat
gccgaggcgttcctcaacgtggcgccgctgacctggaacgaccaccagcacctgctggcc
aaccatcagctcaacgaattcaagccgctgatgacgcggatcgacccggtaaaagtacaa
gccatgaccgacgcctcgaaagaagacctgaccgccagccagaccgacaccggtgccgca
gcacctgcaggcaacggcgaactggccaaggatccgctgtcgccggaaatcgacttcgac
accttcgccgccgtcgacctgcgtgtcgccctgatcgtcaaggccgaagccgtggaaggt
gccgacaagctgctgcgcctgaccctggatatcggtgatgagcaacgcaacgtgttctcc
ggaatcaagagcgcctacccggacccgtccaagctggatggtcgcctgaccatgatgatc
gccaacctcaagccgcggaaaatgaagttcggcatttccgagggcatggtgatggctgcc
ggccctggcggcgaagagatctacctgctgagcccggacagcggcgccaagcctggccag
cggatcaagtaa

DBGET integrated database retrieval system