KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0122
Entry
PSPPH_0122        CDS       T00266                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp02025  Biofilm formation - Pseudomonas aeruginosa
psp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPPH_0122
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPPH_0122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psp02044]
    PSPPH_0122
Secretion system [BR:psp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPPH_0122
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAZ37244
UniProt: Q48Q84
Position
complement(140006..140524)
AA seq 172 aa
MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEFGATQATSATASSSGGASSERVALSDFSI
RKSVDKASAKLFEACCKGTHIAKIQLNVNRAGGDKLTYLTINLEEVVVSSVKAVAGGNQK
GEDNAVSDLPIEEISFNFARIKTTYTQQSRSDGQGGGNVTGGWDRTANKVFA
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcatttgacgcatacatccaaatcgacggcatcccgggcgaagttctggacgacaag
cacaaagactggatcgaagtgctcggctacgagttcggcgctacccaggccacctccgcc
accgccagctcgtcgggcggtgcttcgtccgagcgcgttgcactgagcgacttcagcatc
cgcaaatctgtggacaaggcttctgccaagctgttcgaagcgtgctgcaaaggcactcac
atcgccaagatccagctgaacgtcaaccgtgctggcggcgacaagctgacctacctgacc
atcaacctggaagaagtcgttgtgtcttccgtgaaggctgtagcaggcggcaaccagaaa
ggcgaagacaacgccgtcagcgatctgccgattgaagaaatcagcttcaacttcgctcgc
atcaagactacctacacccaacagagccgttccgatggccagggtggcggtaacgtcact
ggcggctgggaccgcactgcgaacaaagtattcgcataa

DBGET integrated database retrieval system