KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0131
Entry
PSPPH_0131        CDS       T00266                                 

Definition
(GenBank) ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
KEGG Orthology (KO) [BR:psp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psp02044]
    PSPPH_0131
Secretion system [BR:psp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPPH_0131
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AAZ35182
UniProt: Q48Q75
Position
complement(154540..156372)
AA seq 610 aa
MLDDLLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARV
HKKLDDEFPEIVESFLEVLYPHYLRPTPSMSIVEFNMGKQEKVTESYRVARHTELHATPI
DGIVCKFRTCYPVELWPVAVQSASFIEMERSAFNGHSADLIARLRIGLGATSDVLFGKME
LDRLRFFLDGESTLMHQLYELLFNNLAKATLSFEDEGRIREVVLPADALKSVGYGLDEGL
VDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILAGKEIAKVEINFYFSDYDLTDRLA
RLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHVQHEYAVTPDVRLQSSAEVVSIDRVRR
VKKINGNDQVGTCHPFFEPRGDQGPGQSFWIARRRPTQSRQSDGSNMFIRVVDRDLELID
SNNDTLSIRLTCSNRDLPLMLPFGGERGDFNIPSNSVIKDIRCLRKPTATVRVPLGNGVI
WRLISHLSLNHMSLVSKGREVLLELLSLYNYRNVSAIRKQINGIVSVSSEPVVARIGHPR
PNFVRGVGITLKFDESQYTGSGVFLFGMVLDHFFGQYCSMNSFTQLTLRTVQREKRVVQW
PPRTGDQPLV
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgctcgacgatctgctgccctattacgagaaggaactctcgcacctgcgctttctgggc
caggaatttgccgctcaatatccgaagatcgcttcgcgattactgattgagggcgacaac
tgcgaagacccgcacaccgagcgccttatcgaggcgttctcgttcctgtcggcgcgcgta
cacaagaaactcgacgatgagtttcctgaaatcgtcgagtcgtttctggaggtgctgtac
ccgcactacctgcgccctaccccttcgatgtccatcgtcgagttcaacatgggcaagcag
gaaaaggtcaccgaatcctatcgcgtagcccggcacaccgagctgcatgccacaccgata
gacggaatagtgtgcaagtttcgtacgtgctacccggtcgaactgtggccagtggcagtg
caaagtgcttcgttcattgaaatggagcgttcggcgttcaacggccacagtgcagacctg
attgcgcgcttgcgcatcggcctgggtgcgacctccgacgtcctgttcggcaagatggaa
ctggaccgactgcgctttttccttgatggcgaaagcacgctgatgcatcaactgtatgag
ctgctgttcaacaacctggccaaagcgaccctgtcgttcgaagacgaagggcgcattcgt
gaagtggtgctgcccgccgacgccctgaagtctgtcggttatggtctggatgaagggctg
gtggattactcggagcgttcgtttctgggttatcgactgctgcacgaatacttcaccttc
cctgacaagttcatgttcttcgacctgtcaggctttgcccgtattctggctggcaaagag
atcgccaaagtggaaatcaatttctacttttccgactacgacctgacggatcgtctggca
cgcctgacccagaacatcggccgtaacaatttcaagctcaactgcacgcccatcatcaac
ctgttccgccagcaggccgagccgatcaagctgacccacgtccagcatgaatacgcggtg
acaccggatgttcgcctgcaaagctctgccgaagtggtctctatcgatcgcgtgcggcgg
gtgaagaagatcaatggcaacgatcaggtcggcacctgccatccgttctttgaaccacgc
ggtgatcaaggccccggtcagagcttctggatcgcccggcgacgtccgacgcagagccga
caaagcgatggctcgaacatgttcatccgcgtcgtggatcgggatctggaactgattgat
tccaacaacgacacactcagtatccgcctgacgtgcagcaaccgcgatttgccactgatg
ctgccttttggcggcgagcgcggggacttcaacattccctccaactcggtgatcaaggac
atccgctgcctgcgcaaaccgacggcgacggtgcgcgtgccgctgggcaacggcgtgatc
tggcggctcatctcgcacctgtcgctgaaccacatgtcgctggtttcgaaggggcgcgaa
gtgctgttggaactgctgtcgctttacaactaccgcaacgtgtcggcgattcgcaaacag
atcaacgggatcgtttcggtgagcagcgagccggtcgtggcacgcatcggccatccgcgg
ccgaactttgtgcgcggcgtcggtattacgctgaagttcgatgaaagccagtacaccggc
agcggcgtgttcctgttcggcatggtccttgaccacttctttggtcagtactgctcgatg
aacagctttacccaattaacccttcgcaccgtgcagcgcgaaaagagagtggtccaatgg
cccccgcgaacaggcgatcaacccctggtctga

DBGET integrated database retrieval system