KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0507Help
Entry
PSPPH_0507        CDS       T00266                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00010  Glycolysis / Gluconeogenesis
psp00020  Citrate cycle (TCA cycle)
psp00620  Pyruvate metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
Module
psp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_0507 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSPPH_0507 (aceF)
   00620 Pyruvate metabolism
    PSPPH_0507 (aceF)
Enzymes [BR:psp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSPPH_0507 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 PYNP_C HlyD_3 NQRA DEC-1_N CAT
Motif
Other DBs
NCBI-ProteinID: AAZ34971
UniProt: Q48P60
Position
complement(588454..590091)
Genome map
AA seq 545 aa AA seqDB search
MSELIRVPDIGNGEGEVIELMVKVGDRIEADQSILTLESDKASMEIPAPKAGVIKAMKVK
LGDRLKEGDELFELEVEGEAAAAPAPAAESAAAPAAAEKPAEAAPAPAAAAPAPAASASV
QDIHVPDIGSSGKAKIIELMVKVGDSIQADQSLITLESDKASMEIPSPAAGVVESIEVKL
DQEVGTGDLILKLKVEGAAPAAAPAPAASAPAAAPAKAEAAAPAAAPAPKAEAAPAPAKD
GAKVHAGPAVRQLAREFGVELSAVSATGPHGRVLKEDVQVYVKTMMQKAKEAPAGGASGG
SGIPPIPEVDFSRFGEIEEVPMTRLMQLGASGLHRSWLNIPHVTQFDQADITDLEAFRVA
QKGAAEKAGVKLTVLPLLLKSCAHLLKELPDFNASLAPSGKAVIRKKYVHIGFAVDTPDG
LLVPVIRDVDQKSLLQLAAEAAALAEKARNKKLTANDMQGACFTISSLGHIGGTGFTPIV
NAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLSELLADI
RTILL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagttaattcgtgtacccgacatcggcaacggtgaaggcgaagtcattgaattg
atggtcaaggtcggtgatcgcatcgaagccgaccagagcattctgacgctggaatcagac
aaggcgagcatggaaatccctgctcccaaggctggcgtcatcaaggccatgaaggtcaag
ctgggcgaccgtctgaaagaaggcgacgagctgttcgagctggaagtggaaggtgaagcg
gctgccgctcctgcccccgcagccgaatctgccgcggcccctgctgctgccgaaaaaccg
gctgaagctgcaccggcacctgccgctgctgcgcctgctccggcagccagcgccagtgtt
caggacatccacgtgccagacatcggctcgtcgggcaaggccaaaatcatcgagctgatg
gtcaaggtcggtgactccattcaggctgatcagtcgctgattaccctggaatccgacaag
gccagcatggagatcccgtctccggcagcaggcgttgtcgagagcatcgaagtcaagctg
gaccaggaagtcggtaccggcgacctgatcctcaaactgaaagtcgaaggcgcagcgccc
gccgcagctccggcacctgctgccagcgcaccggctgccgctcctgccaaggctgaagct
gctgcaccggccgctgctccagcgccgaaagccgaagcagcacctgctccggccaaagac
ggcgccaaggttcacgcaggcccggctgttcgtcagctggcacgcgagttcggcgtcgag
ctgagcgccgtcagcgccaccggcccacacggtcgcgtgctgaaagaagatgttcaggtc
tacgtcaagaccatgatgcagaaggccaaggaagctccagctggcggcgcaagcggcggc
tcgggcatcccgccgatcccggaagtcgatttcagccgtttcggcgagatcgaagaagta
ccgatgacgcgcctgatgcaacttggcgcttcgggtctgcaccgcagctggctgaacatt
ccgcacgtcacgcaattcgaccaggccgacattaccgacctggaagcattccgtgttgcg
cagaaaggcgctgccgagaaggctggcgtcaagctgaccgttctgccactgctgctcaaa
tcctgcgcccacttgctcaaggagctgccggacttcaatgcctcgctggcacctagcggc
aaggcggtgatccgcaagaagtacgtgcacatcggctttgccgtagacaccccggatggc
ctgttggtaccggttatccgcgacgtcgatcagaagagcctgttgcagctggccgccgaa
gccgcagcactggctgaaaaggcgcgcaacaaaaagctgactgcaaacgacatgcaaggc
gcgtgcttcactatctccagcctcggccacattggcggcaccggcttcacgccgatcgtc
aacgcgccggaagtggctatcctcggagtttccaaggccaccatccagccagtctgggac
ggtaaagccttccagccgaaactgatgctgccgctgtcgctgtcctacgatcaccgcgtg
atcaacggtgcagccgccgcccgcttcaccaagcgcttgagcgaattgctggcggatatc
cgcacaatcctgctgtaa

DBGET integrated database retrieval system