KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0850Help
Entry
PSPPH_0850        CDS       T00266                                 

Gene name
phbA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00071  Fatty acid degradation
psp00072  Synthesis and degradation of ketone bodies
psp00280  Valine, leucine and isoleucine degradation
psp00310  Lysine degradation
psp00362  Benzoate degradation
psp00380  Tryptophan metabolism
psp00620  Pyruvate metabolism
psp00630  Glyoxylate and dicarboxylate metabolism
psp00640  Propanoate metabolism
psp00650  Butanoate metabolism
psp00900  Terpenoid backbone biosynthesis
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
psp01212  Fatty acid metabolism
psp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPPH_0850 (phbA1)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPPH_0850 (phbA1)
   00640 Propanoate metabolism
    PSPPH_0850 (phbA1)
   00650 Butanoate metabolism
    PSPPH_0850 (phbA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSPPH_0850 (phbA1)
   00072 Synthesis and degradation of ketone bodies
    PSPPH_0850 (phbA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPPH_0850 (phbA1)
   00310 Lysine degradation
    PSPPH_0850 (phbA1)
   00380 Tryptophan metabolism
    PSPPH_0850 (phbA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPPH_0850 (phbA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPPH_0850 (phbA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSPPH_0850 (phbA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psp04147]
    PSPPH_0850 (phbA1)
Enzymes [BR:psp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPPH_0850 (phbA1)
Exosome [BR:psp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPPH_0850 (phbA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAZ33929
UniProt: Q48N90
Position
complement(1016424..1017602)
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAAIAAVDLGAAVIRQLLVQTGVDGAQVDEVIMGQVLTAG
AGQNPARQAAIKAGLPFSVPAMTLNKVCGSGLKALHLATQAIRCGDAEVIIAGGQENMSL
SNYVLPGARTGLRMGHTSMVDTMITDGLWDAFNDYHMGITAENLAQQYDISREAQDQFAA
LSQQKAIAAIEGGRFVDEITPILIPQRKGEPLSFATDEQPRAGTTAETLGKLKPAFKKDG
TVTAGNASSLNDGAAAVMLMSAAKAEQLGLPVLARVAAYANAGVDPAIMGIGPVSATRRC
LDKAGWTLDELDLIEANEAFAAQSLSVGKELGLDPQKLNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALALAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgtcgttatcgtcgccgccacccgtaccgccgtcggcagttttcagggttct
ctggctgccattgctgctgtagatcttggcgctgcagtcattcgtcaactgctggtgcag
accggcgtggacggcgcgcaagtcgatgaagtcatcatgggccaggtgctgaccgccggc
gcaggccagaacccggcgcgacaggccgccatcaaggcgggcctgcccttctcggtaccg
gccatgaccctgaacaaagtctgcggctcgggtctcaaggcactgcacctggcgacccag
gcgattcgctgcggtgatgccgaggtcatcattgctggcggccaggaaaacatgagcctg
tccaactacgtactgccgggcgcacgcaccggtttgcgcatgggccacaccagcatggtc
gacaccatgatcactgatggtctgtgggatgcattcaatgactaccacatgggcatcacc
gccgagaacctggcgcagcagtacgacatcagccgtgaagcccaggatcagttcgctgcc
ctgtctcagcaaaaagcgattgcggccattgaaggcgggcgcttcgtcgatgagatcacc
ccgatcctgatccctcagcgcaagggcgagccattatcattcgccactgacgaacagccc
cgcgcgggcaccacggccgaaacactcggcaaactcaaacctgcgttcaagaaggacggc
accgtcaccgctggtaatgcgtcttcgctcaacgacggtgccgccgccgtgatgctgatg
agcgcggccaaagccgagcagttgggcctgccagtgctggcgcgcgtcgccgcatacgcc
aacgcaggtgtcgacccggccatcatgggcatcggcccggtcagtgcaacccggcgctgt
ctggacaaggctggctggacgctggacgagctggatctgatcgaagccaacgaagccttt
gccgcacagtcgctgtcggtcggcaaggaactggggctggacccgcaaaagctcaacgtc
aatggtggcgccatcgcccttggccacccgattggcgcgtcgggctgccgcgtgctggtg
acgttgctgcacgagatgatcaggcgcgatgccaagaagggcctggccacgctgtgcatc
ggcggtggccaaggggttgccctcgcgctggcacgctga

DBGET integrated database retrieval system