KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2248Help
Entry
PSPPH_2248        CDS       T00266                                 

Gene name
glgA
Definition
(GenBank) glycogen synthase
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00500  Starch and sucrose metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPPH_2248 (glgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psp01003]
    PSPPH_2248 (glgA)
Enzymes [BR:psp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     PSPPH_2248 (glgA)
Glycosyltransferases [BR:psp01003]
 Polysaccharide
  Storage polysaccharide
   PSPPH_2248 (glgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AAZ35317
UniProt: Q48JG9
Position
complement(2610453..2611910)
Genome map
AA seq 485 aa AA seqDB search
MSQVSRRKVLFVTSELADLVKTGGLGDVSAALPRAMRHLHDVRVLIPGYPQVINSGNPIH
IISQLGGHAALPPCKVGRMDMKDGLVIYVLICPELYEREGTPYADSDGRDWSDNHIRFAR
LGLAAAEFAAGEVKSQWCPELVHAHDWPAGLAPAYMRWRGQSTPSIFTIHNLAYQGTVST
ASSRELGIPDEAITPEGMEFYGKLSFIKAGMAFASHITTVSATYAREITTPEFGCGLEGF
LQSKANKGQLSGIPNGIDESWDAATDEHLICHFAPNEWTRKEINADYVRELFELDASTGP
LYAVVSRLVYQKGLDLTIGVAEHIVNNGGQIAIIGRGEPEEEDAMRELAARFPGRIGVRI
GFNETDARRMFAGSDFLLMPSRYEPCGLSQMYAQRFGSLPVARNTGGLADTIEDGVTGFL
FKESTIESYTEALNRTFQVFAHRELLNAMRCRAMAAPFNWHQAVEPYADLYRDLLKKNVS
ISSNY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggtcagcagacgcaaagtgttgttcgtgacctcggaattggccgacctggtg
aaaaccggtgggttgggcgatgtatccgccgcattgccacgagcaatgcgccacctgcat
gacgtgcgggttcttattccaggttatccgcaggtcatcaacagcggaaacccgatccat
atcatcagccagctgggcgggcatgctgcactgccaccttgcaaggtgggtcgcatggac
atgaaagatggccttgtgatctacgtgttgatctgccctgagctttacgagcgtgaaggc
acgccttacgccgacagcgatggccgcgactggtccgataaccatattcgttttgcccgt
ctggggctcgcggctgccgaatttgcggctggcgaagtgaaaagccaatggtgccccgag
ctggtccatgcccatgactggcctgccggcctggcacctgcttatatgcgctggcgcggg
cagtccacgccaagcatctttactattcacaatttggcctatcaagggaccgtgagtacc
gcttcgagtcgtgaactgggcattccagatgaagcgatcaccccggaaggcatggagttc
tacggcaagctgtccttcatcaaggcaggcatggccttcgcgagccacattacgaccgtg
agtgcaacctatgctcgggaaatcaccacgccagagtttggttgcggcctggaaggtttt
ctgcagagcaaggctaacaagggtcagctcagcggcatccctaacggaatcgacgaaagc
tgggatgcagcgaccgacgaacacctgatctgccactttgcgcccaacgaatggacgcgc
aaggaaatcaacgccgactatgtgcgtgagctgtttgagctggatgcctcgaccgggccc
ttgtatgcagtggtttcgcgccttgtgtatcaaaaaggcctggacctgaccatcggggtt
gccgagcacatcgtcaacaacggcggacaaatcgcaattatcggtcgcggcgagcccgag
gaagaagatgccatgcgcgagctggccgcacgcttcccggggcgcattggtgtacgtatc
ggctttaatgaaaccgacgcacgacgcatgttcgccggcagcgattttctgttgatgcca
tcgcgctatgaaccctgtggtctgagccagatgtacgcgcaacgcttcggctccctgcct
gtcgcacgcaacaccggcggcctggcggacacaatcgaggacggcgtgaccggcttcctg
ttcaaagaatcaaccatcgaaagctacaccgaagccctgaaccgcacgtttcaggtattc
gcccaccgtgagctgctcaacgccatgcgctgccgtgcaatggctgctcccttcaactgg
catcaggcagtagagccctacgcagatctctaccgtgacctgttgaagaaaaacgtgagc
atttccagcaactactag

DBGET integrated database retrieval system