KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2738Help
Entry
PSPPH_2738        CDS       T00266                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00860  Porphyrin and chlorophyll metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
Module
psp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPPH_2738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psp01007]
    PSPPH_2738
Enzymes [BR:psp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     PSPPH_2738
Amino acid related enzymes [BR:psp01007]
 Aminotransferase (transaminase)
  Class III
   PSPPH_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAZ36745
UniProt: Q48I54
Position
3169427..3170908
Genome map
AA seq 493 aa AA seqDB search
MNKPLDPASMPAIPESAVSQWPDVDSLYRRFDELVKQPIRPIKREAMSKVMGYFDERCQG
SKRLSEAAKKVIPGGVQHNLAFNYPFPLAFAQAKGAHLTDVDGNRYTDFLQAGGPTLLGS
NHPAIRKQVNRILDECGPVTGLLHEYEVKLAELVCEVMPGVDMLRLLGSGTEAVMAAVRL
ARAYTRKKWVIKIGGAYHGWSDQLVYGMRLPGTGRMEAVGIPRGATANTQESPPNNLDAL
RRRLQINRLRGGTAAIMVEPFGPESGTRPVHADFNRQLRALCNEFGALLIFDEVVTGFRA
GLGGAQAYFNVMPDITVLGKCLTGGYPMAGAIGGRRDVMQLLAGGIGTSSRRAFVGGTLS
ANPLSCVAGYYALLEARRLNAPALAGRAGDRMRAGLDEIINRRGLPYVAYNMGSIVHLQT
SGVLLLDTSNPLKLLRARNEAKTRKHMMEEMGAAYTAHGLITLAGSRIYTSLADTDDVID
DALDRFDAVFQLV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacctcttgatcctgccagcatgcctgcaattcccgaatcggctgtatcgcaa
tggccggacgtcgattccctctaccgccggttcgacgaactggtgaagcagcccattcgc
ccgatcaaacgcgaagcaatgagcaaggtcatgggctatttcgacgagcgctgtcagggc
tccaagcgtctttccgaggcagccaaaaaagtcataccgggaggtgtgcaacacaatctt
gcgttcaactatccgtttccgctggccttcgcccaggccaaaggtgcgcacctgacggat
gtcgacggcaaccgctacaccgattttctacaggcgggtggccccactttgttgggttcg
aatcacccggccattcgcaaacaggtcaaccgtattctcgatgaatgcgggccggtgacc
ggcttgctgcatgagtacgaggtcaagctcgccgaactggtctgtgaagtgatgcccggt
gtcgacatgctgcgcttgctgggctcgggcactgaagcggtgatggcagcggtacgcctg
gcacgcgcctacacccgcaagaagtgggtgattaaaatcggcggcgcctatcacggctgg
agcgatcaactggtctacggcatgcgcctgccgggtaccggtcgcatggaggcggtgggt
attccgcgaggtgccacggcaaacacccaggagagcccgcccaataatctggatgcatta
cgccgcaggctgcagatcaatcgccttcgtggcggcactgcagcgattatggtcgaaccc
tttggcccggaaagtggcacacgcccggtacacgccgacttcaaccgacagttgcgtgca
ctgtgtaacgaatttggcgcactgcttattttcgacgaagtagtcaccgggttccgtgcg
ggtctgggcggcgcacaagcttatttcaacgtcatgccggacatcacggtactgggtaaa
tgcctgacaggaggctacccgatggcgggtgccattggcggacgcagagatgtgatgcaa
ctgcttgccggtggcattggtacatcttcccgaagggcgttcgtaggagggacgctgtcg
gccaacccgctgtcgtgcgtcgccggttattacgcgctgctggaggcgcgccgcctgaat
gcgccggcgctagcgggcagggcgggcgaccgcatgcgcgcaggacttgatgaaatcatc
aatcgacgtggcttgccttatgttgcctacaacatgggctccatcgtgcatctgcagact
tccggtgtgctgctgctcgacaccagtaatccgctcaagctgctgagggctcgcaatgag
gccaagacccgcaagcacatgatggaggagatgggggctgcgtataccgctcatggcctg
atcaccctcgcgggcagccgtatctacaccagtctggcagacaccgacgacgtcattgat
gacgcgctcgatcggttcgacgccgtttttcaattggtgtga

DBGET integrated database retrieval system