KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2803Help
Entry
PSPPH_2803        CDS       T00266                                 

Gene name
arnC
Definition
(GenBank) glycosyl transferase ArnC
  KO
K10012  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00520  Amino sugar and nucleotide sugar metabolism
psp01100  Metabolic pathways
psp01503  Cationic antimicrobial peptide (CAMP) resistance
Module
psp_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSPPH_2803 (arnC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PSPPH_2803 (arnC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psp01005]
    PSPPH_2803 (arnC)
Enzymes [BR:psp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     PSPPH_2803 (arnC)
Lipopolysaccharide biosynthesis proteins [BR:psp01005]
 Unusual sugar
  PSPPH_2803 (arnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AAZ36010
UniProt: Q48HZ2
Position
3247294..3248307
Genome map
AA seq 337 aa AA seqDB search
MRPYPIKFVSIVIPVYNERQSLPELLRRTEAACKHLNHRFEIVLVDDGSRDDSAEILQQA
AERSASPFVAVILNRNYGQHAAIMAGFEQCKGDVVITLDADLQNPPEEIPRLVALAEQGY
DVVGTVRSNRQDSAWRRWPSKIINVAVQRSTGVAMSDYGCMLRAYRRTIVDAMLACRERS
TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLVNLMFDLITCMTTTPLRLLSIIGF
SMALLGVLFAALLIILRLIFGAPWAGDGTFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD
VRARPRFFIEKVVRSSSEVVSESVDSSVTPYMNKVAP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgagaccctacccaatcaagtttgtgtcgattgtcatccctgtctacaacgagcgccag
agcttgcccgagttgctacggcgtactgaagcggcctgtaaacacttgaatcaccgcttc
gaaatcgtgctggtggatgacggcagtcgcgacgactcggcagagattcttcagcaggcc
gccgagcgcagcgccagccccttcgttgcggtgattctgaatcgtaactacggtcagcac
gcagcgattatggctgggttcgagcagtgcaaaggtgatgtggtgatcaccctcgacgct
gatctgcagaaccctcccgaggaaattccccggctggtggcgcttgcagagcagggatat
gacgttgtcggcacagtgcgcagcaatcgtcaggactccgcatggcgacgttggccatca
aagatcatcaacgtggcagtacagcgttccaccggcgtagctatgagtgattacggctgc
atgctgcgcgcgtaccggcgcacgattgtcgatgcaatgctggcctgccgggagcgcagc
accttcattccgattttggccaacagttttgcgcggcacacgacggaggtattggtcgat
cacgctgaacgtgaacatggcgactcgaaatacagccccatgcgcctggtcaacctcatg
tttgacctgatcacctgcatgaccactacgcccttgcgcctgctcagcattatcggcttc
agcatggcgctgctcggtgtgctgttcgctgcgttactgatcattctgcgtctgatcttc
ggtgcgccatgggccggtgacggcacgttcgtgctgtttgcggtgttgttcgtattcacc
ggagggcagttcatcggtatgggattactgggtgaatacctgggccgaatgtacagcgat
gtccgcgcgcgcccgcgcttcttcattgaaaaagtcgtgcgcagctcgtccgaagttgtc
agcgaaagcgttgattcctctgtaactccctatatgaacaaggttgcgccatga

DBGET integrated database retrieval system