KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2804Help
Entry
PSPPH_2804        CDS       T00266                                 

Gene name
arnA
Definition
(GenBank) UDP-D-glucuronate dehydrogenase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00520  Amino sugar and nucleotide sugar metabolism
psp01100  Metabolic pathways
psp01503  Cationic antimicrobial peptide (CAMP) resistance
Module
psp_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSPPH_2804 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PSPPH_2804 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psp01005]
    PSPPH_2804 (arnA)
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     PSPPH_2804 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     PSPPH_2804 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:psp01005]
 Unusual sugar
  PSPPH_2804 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AAZ36393
UniProt: Q48HZ1
Position
3248304..3250295
Genome map
AA seq 663 aa AA seqDB search
MSPKAVVFAYHDIGCVGLQALLGAGYEIAAVFTHADDPKEKTFFGSVAQLCARHGIPVHA
PEDPNHPLWVERIDKLAPDFIFSFYYRQLLGDPLLACAKKGALNLHGSLLPRYRGRAPAN
WVLVNGESETGVTLHQMVKRADAGPIVAQQRVSISSTDTALTLHGKLREAAADLLSETLP
LLALGQLSGTPQDETRASCFGRRTPADGLIDWSLPATQLYNLIRAVTQPYPGAFCAVGEN
KLIVWAASAEAGNNGEAPGTVISHDPLRIACGEGSLVINAGQRGDNGLYLSGAQLAREFG
LVEGSQLLDTEKRRPARRTRVLILGVNGFIGNHLSERLLQDDRYDIYGMDIGSDAIERLR
TKPNFHFIEGDISIHTEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIV
RYCVKYNKRVIFPSTSEVYGMCQDASFNEDTSNLIVGPINKQRWIYSVSKQLLDRVIWAY
GQKGLQFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFT
DVADGIEALARIIENRDGCCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRGNFPPFA
GFREVESQSFYGKGYQDVSHRKPSIDNARQLIGWTPGIELSETIGKTLDFFLREAMAEKA
DMR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagccctaaagctgtcgttttcgcctatcacgatattggctgtgtcggcctgcaagcg
ctgctgggcgcaggttatgaaattgctgcagttttcactcacgccgacgaccccaaggaa
aaaaccttcttcggttccgtggctcagctgtgcgcgcgacatggcattcccgtacatgct
cctgaggaccctaatcatcctttgtgggtagaacgcatcgataaactggcccctgacttc
atcttttccttctattaccgccaacttctcggtgatccgttactggcctgcgcgaaaaaa
ggcgcattgaatctgcatggctcgctgttaccacgctatcgcgggcgagcgccggcgaac
tgggtgctggtcaatggcgaaagcgagaccggcgtgaccttgcatcagatggtcaagcgc
gccgatgcagggccgatagtcgctcagcaacgcgtctcgataagttccaccgatacagcc
ttgacgctccacggcaaactgcgtgaagccgccgctgacctgcttagtgaaacgctaccg
ctgcttgccctcgggcaactttcaggcacgccgcaggacgaaacccgtgcaagctgtttc
ggtcgccgcaccccggccgacggtttgatcgactggtcgcttccggccacgcaactgtac
aacctgatacgggcagtcacgcagccctaccctggcgcattttgcgcggtaggcgaaaac
aagttgattgtctgggccgccagtgccgaagcaggcaacaacggcgaagcacccggcacg
gtcatcagtcacgacccattgcgtatcgcctgcggtgagggttcgctggtgatcaacgca
gggcagcgcggcgacaacggcttgtacctcagtggggcacaactggctcgcgagttcggg
ctggtggaaggctcgcaactgctcgatacagaaaagcgccgcccggcccgccgtacccgc
gtgctgatcctaggcgtcaacggtttcatcggcaatcatctgtcagaacgcctgttgcag
gacgatcgttacgacatctacggcatggacatcggttcagacgccattgagcgcctgcga
accaagccgaactttcactttatcgaaggcgacatcagcatccacaccgagtggatcgag
tatcacatcaagaaatgcgatgtggtgctgccattggtggccatcgctacaccgattgaa
tacacccgcaacccgttgcgggtgtttgagctggatttcgaagaaaacctgaagatcgtc
cgttactgcgtgaagtacaacaagcgggtgatcttcccgtcaacgtccgaagtctatggt
atgtgccaggacgcaagcttcaacgaagacacatcgaaccttatcgttggcccgatcaac
aagcagcgctggatctactcggtgtccaagcaactgctggaccgcgtgatctgggcctat
ggtcagaaaggcctgcaattcaccctgtttcgcccgttcaactggatgggcccacgcctg
gaccgactggactcggcgcgtatcggcagttctcgggccatcacccaactgattttgcac
ttggtggaaggtacgccgattcggctggtggacggcggggcccagaagcgctgtttcacc
gatgtcgccgacggtatcgaggcgctggcgcggattatcgaaaatcgtgatgggtgctgt
aatggtcagatcatcaacatcggtaaccccgacaatgaagccagcattcgccaattgggt
gaagagctgctgcgccagttcgaagcgcacccgttgcgcggcaacttcccgccattcgca
ggctttcgcgaagtagaaagccagtccttttatggcaagggttatcaggatgtcagccat
cgcaaaccgagtatcgacaacgcccgacagttgattggctggacaccaggtatcgagctg
agcgaaacgattggcaaaaccctggacttcttccttcgcgaagccatggctgaaaaggcg
gatatgcgctga

DBGET integrated database retrieval system