KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3108Help
Entry
PSPPH_3108        CDS       T00266                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00630  Glyoxylate and dicarboxylate metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSPPH_3108 (aceA)
Enzymes [BR:psp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSPPH_3108 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAZ36622
UniProt: Q48H55
Position
3606209..3607534
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKNVIRTYSAADVVRLRGSVQPEHTFARLGADKLWNLVT
QGARPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKAPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDKPFVTGERTHEGFYKVRAGLDQAISRGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQLITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGVSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacaacaaatagccgctctcgaaaaagactgggccgaaaatccg
cgctggaaaaacgtgatccgtacttactccgcagccgatgtggtccgcttgcgtggctcg
gttcaacccgaacacacctttgcacggctgggcgctgacaaactgtggaacctggtgacc
caaggcgccaggccgtctttccggccagacaaggacttcgtcaactgcatgggcgctctg
accggcggtcaggccgtgcagcaggtcaaggccggtattcaggccatctacctttccggc
tggcaggttgctgccgacaacaactctgccgaatcgatgtacccggatcagtcgctgtac
ccggtcgactcggtgccaaccgtggtcaagcgcatcaacaattcgttccgccgcgccgat
caaatccagtggaaagctggcaaggctccgggtgacgaaggttatatcgattatttcgcg
ccaatagtagccgacgcagaggccggattcggcggcgtgctcaatgcgtacgagctgatg
aaaagcatgatcgaggcgggggccgccggggtgcattttgaagatcagttggcatcggtg
aagaaatgcggccacatgggcggcaaagtacttgtcccgactcaggaagcggtccagaaa
ctggttgctgcgcgcctggccgccgatgtggccggtgtgccgacgatcattctggcccgc
accgacgccaacgctgccgacttgctgacttccgattgcgacccctatgacaagccgttc
gtgacaggcgaacggactcatgagggcttctacaaagtacgtgccggtctggatcaggca
atctcccgcggcctcgcctacgcgccttatgccgacctgatctggtgtgaaaccgccaag
ccggatctggacgaggcacgccgcttcgccgaagcaatcaagaaggagtacccggaccag
ttgctttcctacaactgctcgccgtccttcaactggaagaaaaacctcgacgacgcaacc
atcgccaagtttcagcgcgagctttcggccatgggctacaagcaccagttgatcaccctg
gcgggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgactgcctacgtgaagctacaggaacaggaattcgccgatgctgccaagggctat
accttcgtggcccaccagcaggaagtgggcacggggtatttcgatgacatgaccaccgtg
attcagggcggcgtatcgtcggtaaccgcactgaccggctcgacggaagaagagcaattc
cactga

DBGET integrated database retrieval system