KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3251Help
Entry
PSPPH_3251        CDS       T00266                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00350  Tyrosine metabolism
psp00643  Styrene degradation
psp01100  Metabolic pathways
psp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PSPPH_3251 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PSPPH_3251 (maiA)
Enzymes [BR:psp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PSPPH_3251 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Tom37 MAAL_N GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AAZ37186
UniProt: Q48GS2
Position
complement(3768871..3769506)
Genome map
AA seq 211 aa AA seqDB search
MDLFSYYRSTSSYRVRIALALKGLDYTAIPVNLLLDGGEQRTPGYKAVNPQGRVPALRLD
DGVVITQSLAIIEYLEECYPQPALLAQDAVLRARQRAVAALVGCDIHPLHNVSVLNRLRG
LGHDEPAILSWIEHWIGEGLQAVEQLIEKDGFCFGTSPGLADIYLLPQLYAAHRYNVQLS
AYPRIQRVERLAMQHPAFQQAHPDAQSDKPE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttggacctattcagttactaccgctcgacttcaagttaccgtgtgcgtattgcgctggcc
ctcaaagggctggattacaccgcgatcccggtcaacctgctgcttgatggcggcgagcag
cgcacacccggctacaaggcggtcaaccctcagggcagggtgcctgcattgaggctggac
gatggcgtggtcatcacccagtcactggcgatcattgaatacctggaagagtgctacccg
cagcctgcgttactggcgcaggatgctgttctgcgtgcgcgccagcgggccgttgcggcg
ctggtcggctgtgacattcaccccttgcacaacgtttcggtgctcaaccggttacgcggt
ctgggtcacgacgaacccgctattctgagctggatcgagcactggatcggcgaaggtttg
caggccgtcgagcagttgatcgaaaaggatggtttctgttttggtacgagccccggcctt
gcggacatttacctgttaccacagctgtatgcagcccatcgctacaacgtccaactgagt
gcatacccgcgtatccagcgggtcgagcgtctggccatgcaacatccggcctttcaacag
gcacaccctgatgcacaatcggacaagccggagtag

DBGET integrated database retrieval system