KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3318Help
Entry
PSPPH_3318        CDS       T00266                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSPPH_3318 (recR)
DNA repair and recombination proteins [BR:psp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PSPPH_3318 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSPPH_3318 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Toprim_2 HHH
Motif
Other DBs
NCBI-ProteinID: AAZ34605
UniProt: Q48GK6
Position
complement(3839821..3840423)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDAFRVLPGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRSC
RTLTEEELCPQCADPRRDDTLLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMERISQQGTFTEVILATNPTVEGEATAHYIAQLLHEKGLVASRIAHGVPLGGEL
DLVDGGTLAHSFAGRKPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccagttgatcgatgccttccgcgtgctgccgggcgtc
ggtcagaaaaccgctcaacgcatggcgttgcagctgctggagcgcgaccgcagcggcggc
tcacggctggcgctggccttggggcaggcgatggatggcgttggtcattgccgctcatgc
cgcaccctcaccgaagaggagctctgcccgcaatgcgccgacccgcgccgtgatgacacg
ctgctgtgtgtggtggaagggccgacggatgtctacgcggtggagcagaccggttatcgc
ggtcgctactttgtgctcaagggccatctgtcgccactcgacggcctgggaccggaagcc
atcggcattccgcaactgatggagcgtatcagccagcagggcaccttcactgaggtgatc
ctcgccaccaacccgacggtggaaggcgaagcgacggcgcattacatcgcccagttgctc
cacgaaaaaggcctggtcgcgtcgcgcattgctcacggtgtgccattgggtggcgagctg
gatctggtcgacggcggcaccctggcgcactcgtttgcagggcgcaagccgattgcgttg
tga

DBGET integrated database retrieval system