KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3324Help
Entry
PSPPH_3324        CDS       T00266                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00010  Glycolysis / Gluconeogenesis
psp00053  Ascorbate and aldarate metabolism
psp00071  Fatty acid degradation
psp00280  Valine, leucine and isoleucine degradation
psp00310  Lysine degradation
psp00330  Arginine and proline metabolism
psp00340  Histidine metabolism
psp00380  Tryptophan metabolism
psp00410  beta-Alanine metabolism
psp00561  Glycerolipid metabolism
psp00620  Pyruvate metabolism
psp00625  Chloroalkane and chloroalkene degradation
psp00903  Limonene and pinene degradation
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_3324
   00053 Ascorbate and aldarate metabolism
    PSPPH_3324
   00620 Pyruvate metabolism
    PSPPH_3324
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSPPH_3324
   00561 Glycerolipid metabolism
    PSPPH_3324
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPPH_3324
   00310 Lysine degradation
    PSPPH_3324
   00330 Arginine and proline metabolism
    PSPPH_3324
   00340 Histidine metabolism
    PSPPH_3324
   00380 Tryptophan metabolism
    PSPPH_3324
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPPH_3324
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPPH_3324
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSPPH_3324
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PSPPH_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Sulphotransf KfrA_N
Motif
Other DBs
NCBI-ProteinID: AAZ33463
UniProt: Q48GK1
Position
3845303..3846763
Genome map
AA seq 486 aa AA seqDB search
MTSQSLNSHRVDPDTAQKFYIDGRWSAPLNPASIAVINPATEEVVAHVASGSAADVDRAV
AAARAAFASWSGTSVHARAEIIGRIHELILERKEQLAQAISLEMGAAINSARAMQVPLAA
EHVRVARDLLATYRFKSVESGTAIEREPIGVCGLITPWNWPLYQITAKVAPAIAAGCTVV
LKPSELSPLSALLFAQLVHDAGLPPGVFNLVNGSGPEVGGAMAAHPDIDMISITGSNRAG
ALVAQAAAPTVKRVTQELGGKSPNILLPDADFAKAVPPGVMAAFRNVGQSCSAPTRMIVP
RNRLAEVEALAAETAKAIIVGDPQREETVLGPIANEAQFHRVQAMIDAGLSEGAKLVCGG
PGRVQGHEQGFYTRPTVFSEVDSSMRIAREEIFGPVLCLIAYDTVDEAVAIANDTVYGLG
AHVQGQDLEQARSVASRIRAGQVHLNYPAWNPMAPFGGYKRSGNGREYGVHGFEEYLETK
AIVGFG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacagtccttgaacagccatcgcgttgatccagacaccgcgcagaaattctat
atcgatggtcgctggtcggcgccgctcaacccggccagcattgcggtaatcaacccggcg
accgaagaagtggtggcgcacgtggccagtggctcggccgctgacgtcgaccgcgctgtt
gcggcggcgcgggcggcctttgcgagctggtccggcacctctgtgcacgcccgggcggag
ataatcgggcgcatccacgagcttatcctcgagcgcaaggaacagctggcgcaggccatc
tcgctggaaatgggtgcagctatcaattctgcgcgggcgatgcaagtgccacttgccgcg
gagcacgttcgtgttgcgcgtgacctgctggcgacctatcgcttcaagagcgtcgaaagc
ggcaccgcgattgaacgcgaacccatcggtgtgtgcgggctgatcacgccgtggaactgg
ccgctgtatcaaattactgcaaaagtcgccccggcgattgccgctggctgcacggtggtg
ctcaaacccagcgaactctcgccattgagcgcattgctgttcgcgcaactggtgcatgac
gcgggcctgccgccgggagtgttcaacctggtcaatggcagcggccctgaagtgggcggc
gcgatggctgcgcaccctgacatcgacatgatctcgatcaccgggtccaaccgtgcaggc
gcattggtggcgcaggccgccgcaccgactgtgaaacgggtaactcaggaactgggcggt
aaatcaccgaacattctgctgcccgacgccgacttcgccaaagcggtgccgcccggcgtg
atggccgcgttccgcaacgttggccagtcgtgcagcgcgccgacccgcatgatcgtgccc
aggaaccgactggcggaagttgaagcgctggcagccgagacggccaaggcgatcattgtg
ggagatccgcagcgggaggaaacggtgctggggccgatcgccaacgaggcacagtttcac
cgcgtacaggcgatgatcgatgccgggctgagtgaaggcgcgaagctggtctgcggcggg
ccaggccgtgtacaaggccatgagcaaggcttttacacccggccgacggtattttccgaa
gtggactcgtccatgcgtatcgcccgggaagaaatatttggtccggtgctgtgcctgatt
gcctacgacacggttgatgaggccgtggcgattgccaacgacaccgtttacggtctgggc
gcgcatgtacaggggcaggatcttgagcaggcccgttcggtggcttcgcgcattcgtgcc
ggacaagtgcatctgaactaccccgcctggaacccgatggccccgttcggcggctacaag
cgctcgggcaatggccgcgagtatggcgtgcatggctttgaagagtatctggagaccaag
gctattgtggggtttggttga

DBGET integrated database retrieval system