KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3850Help
Entry
PSPPH_3850        CDS       T00266                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00300  Lysine biosynthesis
psp01100  Metabolic pathways
psp01120  Microbial metabolism in diverse environments
psp01230  Biosynthesis of amino acids
Module
psp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PSPPH_3850 (dapE)
Enzymes [BR:psp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PSPPH_3850 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BNR_2
Motif
Other DBs
NCBI-ProteinID: AAZ34531
UniProt: Q48F49
Position
4406710..4407861
Genome map
AA seq 383 aa AA seqDB search
MTAPTDLSPTLQLACDLIRRPSVTPVDADCQAVMMQRLGNAGFKLEPMRIEDVDNFWATH
GTTDGPVLCFAGHTDVVPTGPVENWQNDPFDALIDEHGMLCGRGAADMKGSLAAMLVAAE
RFVADHPNHKGSVAFLITSDEEGPAHHGTKAVVERLAARKERLDWCIVGEPSSTTLVGDV
VKNGRRGSLGATLTVRGKQGHVAYPHLAKNPIHLAVPALAELAAEHWDHGNDFFPPTSFQ
ISNLNAGTGATNVIPGDLVAVFNFRFSTESTVEGLQQRVAAILDKHELDWHVNWALSGLP
FLTEPGALLDAVSSSIKSVTGRDTKASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNE
RILASDLDVLTEIYYQTLVKLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccctaccgacctgtcgcccacccttcaacttgcctgcgatctgatccgccgc
ccatcagtgacgccggtcgatgccgactgtcaggcagtgatgatgcaacgcctgggcaat
gccggcttcaagctggagcccatgcgtatcgaagacgtcgataacttctgggccacacac
ggcactaccgacggcccggtactgtgtttcgcaggtcatacggacgtggtccctaccggc
ccggtggagaactggcagaacgacccgttcgatgcgttgatcgacgagcacggcatgctc
tgcggacgcggtgcagcggacatgaaaggcagcctggcagccatgctcgtggccgccgag
cgctttgtagccgatcacccgaatcacaagggttcggtggcattcctgatcaccagtgac
gaagaaggcccggcgcaccacggtaccaaggctgtcgtcgaacgtctggcagcgcgcaag
gagcgtctggactggtgcatcgtcggcgaaccttcgagcaccacgctggtgggcgatgtg
gtcaagaacgggcgtcgtggctcgctgggcgccaccctcaccgtgcgcggcaaacagggc
catgtggcttacccgcatctggcgaagaaccctattcaccttgcagttccggcacttgcc
gaactggctgcagagcactgggaccatggcaacgatttcttcccgccaaccagcttccag
atctccaacctgaacgccggcacgggtgcaaccaatgtcatcccgggtgatctggtggca
gtattcaacttccgtttttcgaccgagtcgaccgtcgaaggcttgcagcagcgtgtcgcc
gccatcctcgacaagcatgagctggactggcatgtgaactgggcgttgtccggcctgccg
ttcctgaccgagccgggcgcattgctggacgccgtgtcgtccagcatcaaaagcgtcacg
ggccgtgacaccaaagcctcgaccagcggcggaacctccgacggccgtttcatcgcgacc
ctgggtacgcaagtggttgaactggggccggtcaacgcgacgattcaccaggtcaacgag
cggattctggccagcgatctcgacgtgctgaccgagatctactaccagaccctggtcaag
ttgctcgcctga

DBGET integrated database retrieval system