KEGG   Psychrobacter sp. P2G3: AK823_00800Help
Entry
AK823_00800       CDS       T04386                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AK823_00800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pspg02022]
    AK823_00800
Two-component system [BR:pspg02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   AK823_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AMN48615
Position
complement(186539..187303)
Genome map
AA seq 254 aa AA seqDB search
MTDNKSTDTMTQRILVVDDDARLRSLLQRFLEDDGFVVRTAHDASQMDKLMQRELFSLVV
LDLMLPGEDGISICRRLREDNGDIPIIMLTAKGGDADRIAGLEAGADDYLPKPFNPKELL
ARIKAVLRRQNRELPGAPSYQLEVVEFGPWTLDLSTRTLKRDGNVVTLTTGEFSVLKALV
QHPREPLTRDKLMNLARGREWGAMERSIDVQVSRLRRLIEDNPSQARYIQTVWGVGYVFV
PDEAEPEQTTATTD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactgataataaaagcaccgatactatgactcagcgaattttggtcgttgatgacgat
gctcgcttacgttctttgttgcagcgttttctggaagatgacggcttcgtagtacgtact
gctcatgatgccagtcagatggacaaattgatgcagcgtgaactgttttctttagtagtg
ctagacttaatgctaccaggagaagacggtatcagtatttgtagacgtctgcgtgaagac
aatggagatattccgatcatcatgcttacggccaaaggtggtgatgccgatcgcattgct
ggacttgaagctggtgcagatgattatttgcccaagccctttaatccaaaagagctacta
gcacgtatcaaagcggtactacgtcgtcaaaaccgtgagttacctggtgcgccaagctat
cagttagaagtggttgaatttgggccatggacgcttgatttgtctacgcgtacgcttaaa
cgcgatggcaatgtagttactttgactaccggtgaattttctgtactaaaagcacttgta
cagcatccacgcgaacctttaactcgtgataagcttatgaatcttgcgcgtggccgtgag
tggggtgctatggagcgctcaatcgatgtacaggtgtcacgcctacgtcgtctgattgag
gataacccttcacaagctcgctatattcaaacggtctggggcgtaggttatgttttcgtt
cctgacgaagcagaaccagaacaaacgactgccacgacagattag

DBGET integrated database retrieval system