KEGG   Psychrobacter sp. P2G3: AK823_01490Help
Entry
AK823_01490       CDS       T04386                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00740  Riboflavin metabolism
pspg00790  Folate biosynthesis
pspg01100  Metabolic pathways
pspg01110  Biosynthesis of secondary metabolites
pspg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AK823_01490
   00790 Folate biosynthesis
    AK823_01490
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AK823_01490
Enzymes [BR:pspg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AK823_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AMN48734
Position
complement(342259..342942)
Genome map
AA seq 227 aa AA seqDB search
MSYQFITSAKLPTRHGEFDLHVFENEDGQEHVMLTVGLPVVNPLLEENAAPTTPTNEQHK
LADHPIPLVRIHSECLTGDAFGSLKCDCGAQLNTAMQAIQATGCGAILYLRQEGRGIGLT
NKIRAYALQDQGHDTLDANLMLGLPADARIYDMCSPMLAHVGVDEVRLITNNPDKVAYLS
ENGVNVVERVPLVVGVNDSNADYLATKRDRMGHLFDKEFYTEAHLNK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcaatttattaccagcgcaaaactacctactcgtcatggcgagtttgatctt
catgtatttgaaaatgaagacggtcaagagcatgtaatgcttaccgtcggcctaccagtg
gtaaacccattgttagaagagaacgccgcgccaacaactcctacaaatgagcagcataaa
ttagcagatcatcccatcccgttagtccgtattcactctgagtgcttgacaggcgatgct
tttggctcgttaaaatgcgactgcggtgcacagctcaatacagccatgcaagcaatacaa
gcaactggctgcggtgctatcttatatctgcgtcaagaaggtcgcggtattggtctaacc
aataaaatccgcgcatatgccttacaagatcaaggccatgataccctagatgccaacctc
atgttaggtctacccgctgatgcccgtatctatgatatgtgtagtcctatgcttgcccat
gtaggggttgatgaggttcgccttatcaccaataaccctgataaggtggcctatctaagc
gaaaatggtgtcaatgtggtcgaacgtgtaccgttggtcgttggcgttaatgatagcaat
gctgactatctagcgaccaaacgtgaccgcatgggtcatctttttgataaagaattctat
actgaggctcatctcaataaataa

DBGET integrated database retrieval system