KEGG   Psychrobacter sp. P2G3: AK823_01865Help
Entry
AK823_01865       CDS       T04386                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00020  Citrate cycle (TCA cycle)
pspg00480  Glutathione metabolism
pspg01100  Metabolic pathways
pspg01110  Biosynthesis of secondary metabolites
pspg01120  Microbial metabolism in diverse environments
pspg01130  Biosynthesis of antibiotics
pspg01200  Carbon metabolism
pspg01210  2-Oxocarboxylic acid metabolism
pspg01230  Biosynthesis of amino acids
Module
pspg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK823_01865
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AK823_01865
Enzymes [BR:pspg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AK823_01865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AMN48792
Position
438938..440197
Genome map
AA seq 419 aa AA seqDB search
MSYDKVIVPRDGEKITVNADLSLNVPNNPIIPFVEGDGIGVDITPVMIKVVNAAVDKAYH
GKKSIIWMEAYLGEKAAKIYDGDYLPSETLEILKDYVISIKGPLTTPVGGGFRSLNVAVR
QELDLYVCQRPVRWFEGVPSPVHHPELTDMVIFRENSEDIYAGIEWKAGSDEAKKIIKFL
KEEMGVTKIRFSDDCGIGIKPVSKEGSQRLVRKAIQHAIDNDLPSVTLVHKGNIMKFTEG
AFKEWGYEIAAERFGAELLDGGPWMTMKNPKTGNDIIIKDVIADAFLQQILMRPADYSVV
ATLNLNGDYISDALAAEVGGIGIAPGANKGGAVSVYEATHGTAPKYAGQNKVNPGSLILS
AEMMLRDMGWVEAADLIIEGIQGAIANKTVTYDFERLMPDAILLSTSEFGKAIIKHMDA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgataaggttatcgtaccaagagacggagaaaaaatcaccgtaaacgctgat
ttatcgttgaatgtccctaataatccaatcatcccattcgttgaaggtgatggtatcggt
gtagatatcactcctgtcatgataaaagtggttaatgctgcagtggataaggcatatcat
ggcaaaaaatcaattatctggatggaggcttacttaggtgaaaaagcagccaaaatttac
gatggtgattacctgccaagtgaaacgctagagattttaaaagactatgttatcagtatt
aaaggcccattgaccacgcctgttggcggcggctttcgctcgttgaacgtggcagtacgt
caagagcttgatttatatgtctgtcagcgtccagtacgttggtttgaaggcgtaccaagc
ccagttcaccatccggagctaactgatatggttattttccgcgaaaactcagaagatatc
tatgcaggtattgagtggaaagcgggcagtgatgaagccaagaaaatcatcaaattctta
aaagaagaaatgggtgtcacgaagattcgcttctctgatgactgtggtatcggtatcaag
ccagtatcaaaagaaggctctcagcgcctagtgcgtaaggccattcaacatgctatcgat
aatgatttgccaagtgtgacactggttcacaaaggtaatattatgaagttcaccgaaggt
gcgtttaaagagtggggctatgagatagccgcagagcgtttcggtgctgagctattagat
ggtggtccttggatgacgatgaagaacccaaaaacgggtaatgatattatcatcaaagac
gtgatcgctgatgcgttcttacaacagattttgatgcgccctgctgattactcagtagtc
gcaacactgaacctgaacggtgactatatctcggatgcactagcagctgaggttggtggt
attggtatcgcaccgggagctaataaaggtggagctgtctctgtctatgaagcgactcat
ggtactgcgcctaagtatgctggccagaacaaagtaaacccagggtcactgattctatcg
gctgagatgatgttacgtgatatgggctgggtcgaagcagcagacctcattatcgaaggt
attcaaggtgctatcgctaataagacggtcacttacgacttcgaacgcttaatgccagat
gctatcttgcttagtacttctgagtttggtaaggcgataattaagcatatggatgcatag

DBGET integrated database retrieval system