KEGG   Psychrobacter sp. P2G3: AK823_02930Help
Entry
AK823_02930       CDS       T04386                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AK823_02930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pspg03011]
    AK823_02930
Ribosome [BR:pspg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AK823_02930
  Bacteria
    AK823_02930
  Archaea
    AK823_02930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMN48974
Position
694720..695049
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKVRLVADEVRGKSIERALDILTYSNKKGAVFVKKCLNSAIANAEH
NHGLDIDDLKVATIYVDEGITLKRILPRAKGRADRISKRTCHITIKVGE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgcaaaattacgcggtgccgccatctcggcacaaaaagttagactcgtt
gctgatgaagttcgtggcaaatctatcgaacgtgctttggatatcctaacgtatagcaat
aaaaaaggcgctgtgtttgttaagaaatgtcttaactcagccatcgccaatgccgaacat
aatcatggattagatatcgacgacctaaaagtcgctactatctatgtcgatgaaggcatc
acgctaaagcgtatcctaccacgtgctaagggtcgtgctgatcgtatcagtaaacgtacc
tgtcacatcactataaaggtaggagaataa

DBGET integrated database retrieval system