KEGG   Psychrobacter sp. P2G3: AK823_04005Help
Entry
AK823_04005       CDS       T04386                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pspg  Psychrobacter sp. P2G3
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AK823_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Med5
Motif
Other DBs
NCBI-ProteinID: AMN49150
Position
927099..928706
Genome map
AA seq 535 aa AA seqDB search
MGISSSSTEPTKPVGNMRINLFFAILLIAMTSYFLWWGFDYTLRQQTTLFIVATAFGVFM
AFNIGGNDVANSFGTSVGSGTLTIPQALCVAAIFEVSGAVLAGGEVTDTIRSGIVDLDGL
SVTPNQFIYVMLSALIAAAFWLLFATRKGLPVSTTHSIIGGVVGSSIVLGITLGGTEMAL
STVDWGTVGTIAISWVLSPLLGGVLSYLLYGRIKKNIIEYNDKTEAHIATLKGNKKTLKQ
NHKEFLDALTESEQLAYTSAMLRDQEIYKDDDCIVEELETDYYKRLYEIENERSNLDTLK
ALKQWVPIIAAAGGAVMTSLVVFKGLKNVNNGLTTLQGFLIMGMIAALVWLATFIYTKSI
RGKHKEDLTKATFIMFSWMQVFTASAFAFSHGSNDIANAVGPFAAIMDVIRTNSISTEAA
VPPAVMLTFGVALIVGLWFIGKEVIQTVGTNLAKMHPASGFSAELAAAAVVMGASTMGLP
VSSTHTLVGAVLGIGIVNRDTNWKLMKPIGLAWIVTLPAAASMSAISYIVLVNIF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggtattagcagcagttctacagagccgaccaaaccagttggcaatatgagaatcaat
ctattttttgctattttactgattgcgatgaccagctattttttatggtggggattcgat
tacaccctgcgtcaacagacaacgctattcattgttgcgacggcttttggtgtcttcatg
gcattcaatatcggtggtaatgatgtcgccaactcttttggtacctcagtaggttctggc
accttgactatcccgcaagcgttatgtgtggcagcgatatttgaagtgtcgggggcagta
ctggctggtggtgaagtgaccgatactattcgaagcggaattgtcgatttagatggtctg
agtgtcacgcccaatcagttcatctatgtcatgctttcagctttgattgctgctgcattt
tggctgttgtttgctacgcgtaaaggcttaccagtttcaacgacgcactccattatcggt
ggggttgttggtagttccattgtccttggcatcactctgggcggtactgagatggcgcta
tcaacggtagattggggaaccgttggaactattgctatctcttgggtattgtcgccgcta
ctaggtggtgttctgtcctacctcctatatggacggattaagaaaaacatcattgaatat
aatgataaaacagaggcgcacattgcgacactcaaaggcaacaaaaaaaccttaaagcaa
aatcataaagagtttttagacgctctaacagagtcagagcaactcgcttatacttcagcg
atgttacgtgaccaagaaatctacaaagatgatgattgtattgttgaagaattagaaacc
gattattataaacggctttatgaaattgaaaacgagcgcagtaaccttgatacgctaaaa
gcacttaaacaatgggtacctattattgccgctgcaggtggcgcagtaatgacctctcta
gtcgtctttaaaggcttgaaaaatgtcaataacggcttgacgaccctgcagggttttcta
atcatggggatgatagcggcgttggtgtggctcgcgacctttatctataccaagagtatc
cgtggtaaacataaagaagacttaaccaaagcgacatttattatgtttagctggatgcag
gtctttaccgcatcagcctttgcttttagtcatggttcaaatgatatcgctaacgctgtt
ggtccatttgcagcgatcatggatgtgattcgtactaatagtatttccacagaagctgcg
gtaccacctgctgtgatgctgacctttggtgtggcacttattgttggtctttggttcatt
ggtaaagaagttatccaaacagtgggtaccaatttggcaaaaatgcatcctgcttctggt
ttctcagctgaattggctgccgctgctgtggttatgggtgcatcgacgatgggtctgcca
gtatcgagcacccataccttagtaggtgcggtactgggtattggtattgttaatagagat
accaactggaaactcatgaagccgattggtctggcttggatcgttactcttcctgcagcg
gcttcaatgtctgcaatcagttatatcgtattggtcaacatcttttaa

DBGET integrated database retrieval system