KEGG   Psychrobacter sp. P2G3: AK823_04905Help
Entry
AK823_04905       CDS       T04386                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00020  Citrate cycle (TCA cycle)
pspg00620  Pyruvate metabolism
pspg00650  Butanoate metabolism
pspg01100  Metabolic pathways
pspg01110  Biosynthesis of secondary metabolites
pspg01120  Microbial metabolism in diverse environments
pspg01130  Biosynthesis of antibiotics
pspg01200  Carbon metabolism
Module
pspg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pspg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK823_04905
   00620 Pyruvate metabolism
    AK823_04905
   00650 Butanoate metabolism
    AK823_04905
Enzymes [BR:pspg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AK823_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: AMN49297
Position
1163289..1164833
Genome map
AA seq 514 aa AA seqDB search
MGSINHEERVQHEGLREKIMSAEQAASFVQNGMTLGVAGFTGAGYPKFVPTAIASRAKDA
HARGEKFGIGMLTGASTAHDCDGVLAEANCVNFRAPFQSDPAMRNHINAGNTHYVDMHLS
HFEQQVRFGFYGDMDIALIEATGITPEGKIIPSMGIGTNNQWLKTAKKVIIEVNSRQSIM
LEGMHDIPADLGEPPFRQPIPIVKPDDRIGTPYLECDLDKIIGIVMTDAPDRNSKFADPD
DNSKTIASQIIEFLDHEVKKGRLPKNLLPLQSGVGNVANAVLMGLQDSPFDDLMGYTEVL
QDGMLDLVLSGKMKSASATALSFSPDALQRFNDNIEFLSDKLVLRPQEFTNHPEVIRRLG
IIAMNAMIEADIYGNVNSTHIMGTKMMNGIGGSGDFTRNSHFSFFVSPSTAKGGAISTIV
PMVSHHDHSEHDVMFLVTEQGFADLRGKSPRQRAKLIIDNCAHPDYRPMLQDYYDRAAKA
SGLQTPHLLNEALSWHQRFVETGDMRINKMRIAV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaattaaccacgaagagcgcgttcaacatgaaggcttgcgtgaaaagatcatg
tctgctgaacaagcagcttcatttgtacaaaacggaatgacgcttggtgttgcaggattt
acgggtgcaggctacccgaagttcgtaccaacggctatcgctagtcgtgctaaagatgct
cacgctcgtggcgaaaaattcggcatcggcatgttaacgggtgcgtcaaccgctcatgat
tgtgatggtgtgttggcagaagccaactgtgttaatttccgtgcgcctttccaatctgat
cctgccatgcgtaaccacatcaatgctggtaacactcactacgttgatatgcacttatca
cactttgagcagcaagttcgttttggcttctatggcgatatggatattgcattgattgaa
gcgactggcatcacgccagaaggtaaaatcattccttcgatgggtattggtaccaataac
cagtggctcaaaactgccaaaaaagtcatcatcgaagtcaactcgcgtcaaagtataatg
ttagagggcatgcatgatatcccagcagacctcggtgagccgccgttccgtcagcctatt
cctattgtcaaaccagatgaccgcatcgggacaccgtacctagagtgtgatctcgataag
attatcggtatcgtaatgaccgatgcgcctgatcgtaatagcaagtttgctgatccagat
gataactctaaaacgattgcttcacagattattgaattcttagatcatgaagtcaaaaaa
ggccgcttgccaaaaaacctattaccactacagtctggtgtgggtaacgttgcaaacgca
gtattaatgggtctacaagatagcccgtttgatgatttgatggggtacaccgaagtactc
caagacggtatgcttgatcttgtgcttagcggcaaaatgaagtcagcttcggcaacggca
ttatcgtttagcccagatgcgctacagcgtttcaatgataatatcgagtttttgagtgac
aaactcgtcctacgcccgcaagaattcactaaccatccagaggttatccgtcgtcttggt
attatcgctatgaatgcgatgatcgaagccgatatttacggtaacgtcaactcaacccat
attatgggtaccaaaatgatgaacggtattggtggttcaggcgacttcactcgtaactca
catttctcgttctttgtcagcccatcaacagcgaaaggtggggctatatctactatcgtg
ccgatggtatcgcatcacgaccactctgagcatgatgtgatgttcttggtgactgagcaa
ggatttgcagatttgcgtggtaagtcgccgcgtcaacgcgccaagcttatcatcgataac
tgtgcgcacccagactatcgcccaatgctgcaagattactatgaccgtgctgctaaggcc
agtggcctacaaacgccgcatctcttaaatgaagcattgtcatggcatcagcgttttgtt
gagacgggagatatgcgcataaataagatgcgtatagctgtatag

DBGET integrated database retrieval system