KEGG   Psychrobacter sp. P2G3: AK823_05040Help
Entry
AK823_05040       CDS       T04386                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00860  Porphyrin and chlorophyll metabolism
pspg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AK823_05040
Enzymes [BR:pspg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AK823_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AMN49323
Position
1191800..1192360
Genome map
AA seq 186 aa AA seqDB search
MTLYIWRHPKPFEAEGICIGQTDIGVDRRKLKRLANQVERFVRLHQLPRVIWVSPLQRSL
KVGQILAHRGFQCRIAPELAEIDFGEWDGRPWEQIAKQEIDDWCDNFAHFTPDNGESLQQ
LFDRVEGWLNKVLAEQDNTPILAIGHAGWINAAKIMDTGQDVPKTAADWPSSVAYGECSC
LTLARI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactctttacatttggcgtcacccgaaaccctttgaggctgagggtatctgtattggt
cagacggacataggggtagataggcgtaaattaaaacgccttgccaatcaggtcgagcgc
tttgtgcgtctgcaccaattacctagagtcatttgggtaagcccattacagcgctcacta
aaagttggtcagatattggcgcaccgtggctttcaatgtcgaatcgcgcctgagcttgct
gagattgattttggcgaatgggatggtcgcccttgggagcaaatcgctaagcaagagatt
gatgactggtgtgataactttgcgcactttacgcccgataatggggaaagtttgcagcag
ttatttgaccgtgttgagggttggttgaataaggttttggctgaacaagacaacacccca
atactagcaattggtcatgctggctggattaatgctgccaagattatggatactgggcaa
gatgtaccgaagacagcagctgattggccctcttcagttgcatatggggaatgtagttgt
ttgacgcttgcaaggatttag

DBGET integrated database retrieval system