KEGG   Psychrobacter sp. P2G3: AK823_06830Help
Entry
AK823_06830       CDS       T04386                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00071  Fatty acid degradation
pspg00072  Synthesis and degradation of ketone bodies
pspg00280  Valine, leucine and isoleucine degradation
pspg00310  Lysine degradation
pspg00362  Benzoate degradation
pspg00380  Tryptophan metabolism
pspg00620  Pyruvate metabolism
pspg00630  Glyoxylate and dicarboxylate metabolism
pspg00640  Propanoate metabolism
pspg00650  Butanoate metabolism
pspg00900  Terpenoid backbone biosynthesis
pspg01100  Metabolic pathways
pspg01110  Biosynthesis of secondary metabolites
pspg01120  Microbial metabolism in diverse environments
pspg01130  Biosynthesis of antibiotics
pspg01200  Carbon metabolism
pspg01212  Fatty acid metabolism
pspg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK823_06830
   00630 Glyoxylate and dicarboxylate metabolism
    AK823_06830
   00640 Propanoate metabolism
    AK823_06830
   00650 Butanoate metabolism
    AK823_06830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AK823_06830
   00072 Synthesis and degradation of ketone bodies
    AK823_06830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AK823_06830
   00310 Lysine degradation
    AK823_06830
   00380 Tryptophan metabolism
    AK823_06830
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AK823_06830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AK823_06830
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AK823_06830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pspg04147]
    AK823_06830
Enzymes [BR:pspg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AK823_06830
Exosome [BR:pspg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AK823_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AMN49627
Position
1636130..1637332
Genome map
AA seq 400 aa AA seqDB search
MLDAYIYDGLRSPFGRHGGALATVRPDDLIATVMKTLVEKHQLPNDIFDEVLIGNTNQAG
EDSRNIARNAALLAGLDVTTPGQTVNRLCASGLSTIIDAARSITCNEGDVILAGGVESMT
RAPFVFAKTEQPFSREFKVFDTTIGSRFPNPLLTKEFGSDSMPQTGDNVARKYGITREEA
DKFAAASQAKYQTAKQAGFFDDEITPIMVSQGKKLPEKAITEDEHPRATSTVEALQKLKP
LNENGVVTAGNASGINDGAAALIIGSKQAEEKLGFKPIAKILSSGAMGVEPSIMGVGPVE
AIKLALKRANLTLDDMSIIEINEAFASQVLGCLKGLDIDFDDKRVNPNGGAIAVGHPLGA
SGARLALSTARELQRTGEKYAVVSLCIGIGQGLAMVIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcctatatttatgatggattaagaagcccttttggtcgccatggtggagca
ttagcaaccgtgcgtcctgatgacttaatcgccacagtgatgaaaactctggtcgaaaag
caccaattacctaacgatatctttgatgaagtactgatcggtaacaccaatcaggccggt
gaggactcacgcaatattgctcgtaatgctgcattgctagcgggactagatgtcacaacg
cccggtcaaaccgtcaaccgtctatgtgcctcgggattatctacaattattgatgctgct
cgtagcattacttgtaatgagggtgacgtgattttagcgggtggcgttgagtcaatgacc
cgtgcaccctttgtctttgctaagaccgagcagccttttagtcgtgaatttaaagtattt
gataccactattggcagccggtttcccaatcctcttttgactaaagagtttggcagcgat
agcatgccgcagacgggcgataatgtcgctcgcaaatacggtatcactcgtgaagaggcg
gataaattcgcagcagcctcgcaagctaaatatcaaaccgccaagcaagctgggttcttc
gatgatgaaataacgccaattatggtatcgcaaggtaaaaaattacctgaaaaagcgata
acagaagatgagcatcctcgcgccacatctactgtggaagcactgcaaaaactgaaacct
ttaaatgagaatggcgtagttacagcagggaacgcatcgggcattaacgatggggcggct
gcgctgattattggctcaaagcaagcagaagaaaagttaggctttaaacctatcgccaaa
attctatcttcaggtgccatgggtgttgagcccagtattatgggcgtaggccctgttgaa
gccattaaactggcattgaaacgtgccaatttgactcttgatgatatgtccatcattgag
attaatgaagcatttgcctcgcaagttctgggttgccttaagggtttggatatagatttt
gatgacaagcgcgtcaaccccaatggcggggcgattgccgtcgggcatccgctgggtgca
tcaggcgcaagacttgcgttgagtacagcgcgcgagctacagcgcacgggcgaaaaatac
gcggtagttagtttgtgcattggtatcgggcaagggcttgccatggtgattgaacgagtc
taa

DBGET integrated database retrieval system