KEGG   Psychrobacter sp. P2G3: AK823_09045Help
Entry
AK823_09045       CDS       T04386                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00260  Glycine, serine and threonine metabolism
pspg00630  Glyoxylate and dicarboxylate metabolism
pspg00670  One carbon pool by folate
pspg01100  Metabolic pathways
pspg01110  Biosynthesis of secondary metabolites
pspg01130  Biosynthesis of antibiotics
pspg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AK823_09045 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AK823_09045 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AK823_09045 (gcvT)
Enzymes [BR:pspg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AK823_09045 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AMN50000
Position
2243409..2244584
Genome map
AA seq 391 aa AA seqDB search
MTDTSSQDNNSQAPQRTPLYQSHVDSDGKMVDFSGWELPIHYGSQIEEHEAVRTDAGMFD
VSHMVVADVKGAETKAWLQKLLANDVNKLKTVGKALYSPMLNEQGGIIDDLIVYLMNADE
TEYRIVSNAGTRDKDIAHFDKVAEAFEVAITERPDLAMLAVQGPNAVAKLAQAKPSWADI
LDELKPFVGADLTDIEGKDWFVARTGYTGEDGVEVIMHADDAPAFFEQLKANGIKPAGLG
ARDTLRMEAGMNLYGHDMDENISPYECNMGWTLALKDERDFVGREAMVSKRQQAKDDSTA
MKQVGLLLTTRGVLREGMEVTINQGTDNEQNGIITSGTFSPSLKNSIAIARVPASLSDDD
KVQIDLRGKGKFVDARVLKLPFVRNGKQQFD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatactagttctcaagacaataatagccaagctcctcaacgtacacctctatat
cagtctcacgtcgatagtgatggcaaaatggtggatttttctggctgggagctgccaatt
cattacggctcacaaatcgaagagcatgaggccgtacgtactgatgctgggatgtttgac
gtctcacatatggtagtggctgacgtcaaaggcgctgaaaccaaggcatggctacaaaaa
ctactagcaaacgatgtcaataaactaaaaaccgttggtaaagccttatactcgcctatg
cttaatgagcaaggcggcatcattgacgatcttattgtttacttgatgaatgcggatgaa
accgaatatcgtatcgtgtcaaatgctggtacccgtgataaggacatcgctcactttgat
aaagttgctgaagcttttgaggttgctattaccgaacgtccagatcttgctatgcttgcc
gttcaagggccaaatgcagtagcaaaactggcacaagctaaaccaagctgggctgatatt
cttgacgagcttaagccctttgttggtgctgaccttactgatatagaaggtaaagattgg
tttgtcgctcgtactggctacactggcgaagatggcgtcgaagtcattatgcatgctgat
gatgcgcccgcattctttgaacagttaaaagctaatggcattaaacctgctggccttggt
gcgcgtgacaccctacgtatggaagctggcatgaacctctatggtcatgatatggacgaa
aatatcagtccttatgagtgcaacatgggttggacactggcactaaaagacgagcgcgat
tttgttggccgtgaagccatggttagcaaacgtcagcaagcaaaagatgacagcactgcg
atgaagcaagttggtctactactgactacccgtggcgttttacgtgaaggcatggaagtg
actatcaatcagggcacagataatgagcaaaacggcatcattaccagtggtacgttctcc
cctagcctcaaaaactctatcgctatcgcacgcgttccagccagcttatcagatgacgat
aaagtacaaatcgacttacgcggtaaaggtaagttcgtagatgctcgtgtccttaagtta
ccatttgtacgcaatggcaagcagcagtttgactga

DBGET integrated database retrieval system