KEGG   Psychrobacter sp. P2G3: AK823_10150Help
Entry
AK823_10150       CDS       T04386                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
pspg  Psychrobacter sp. P2G3
Pathway
pspg00633  Nitrotoluene degradation
pspg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pspg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AK823_10150
Enzymes [BR:pspg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AK823_10150
  1.-  
   1.-.-  
    1.-.-.-  
     AK823_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF4216
Motif
Other DBs
NCBI-ProteinID: AMN50182
Position
complement(2514973..2515629)
Genome map
AA seq 218 aa AA seqDB search
MKDITDAMNWRYSVKDYDPTKKLSADDFQSLKDVLRLSPSATNIQPWHYVIADDDAGRAR
VAKGTDGHHEANSSKIKNASHVIVFCSRAYADNEYLSELLEKEDADGRFTEPKRKTQMDE
KRKKSVNKHRFTEKDEPFWLAKQVYITMGALLLGAATLGIDATPMEGVDFEVLDDELDLN
SKGLTAVGVVCLGYRSGDGYNVELPKSRLSEEAVFSKL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatcactgatgcgatgaattggcgctatagcgttaaagactatgaccctacc
aaaaagctgtcagctgatgactttcagagtctaaaagatgtgttgcgcttgagtccttca
gcgaccaatattcaaccttggcactatgtgattgccgatgatgatgctggtagagctaga
gttgctaaagggactgatgggcatcacgaggctaattcatcaaaaataaagaatgcctca
cacgttatcgttttttgtagtcgtgcttatgcagataatgagtatttgagtgaattactc
gaaaaagaagacgctgatggtcgttttactgaaccgaaacgcaaaacacaaatggatgaa
aaacgtaagaaatcagttaataagcaccgttttacagaaaaagatgagccgttttggttg
gctaagcaggtttatattacgatgggtgctttattacttggcgcagcaacgcttgggatt
gacgcgacaccgatggaaggtgtcgattttgaggtgctcgatgacgagcttgatttgaat
agtaaaggcttaaccgctgtaggagtggtctgtcttggctatcgtagtggtgatggttac
aatgtagaattaccgaaatcgcgcttgagtgaagaggctgtttttagcaagctataa

DBGET integrated database retrieval system