KEGG   Pseudohongiella spirulinae: PS2015_1698Help
Entry
PS2015_1698       CDS       T04158                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00450  Selenocompound metabolism
pspi00970  Aminoacyl-tRNA biosynthesis
pspi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PS2015_1698
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PS2015_1698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pspi01007]
    PS2015_1698
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pspi03016]
    PS2015_1698
Enzymes [BR:pspi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PS2015_1698
Amino acid related enzymes [BR:pspi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PS2015_1698
Transfer RNA biogenesis [BR:pspi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PS2015_1698
 Prokaryotic type
   Other AARSs
    PS2015_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DALR_1
Motif
Other DBs
NCBI-ProteinID: ALO46350
UniProt: A0A0S2KE01
Position
complement(1856449..1858542)
Genome map
AA seq 697 aa AA seqDB search
MTQRQILVTSALPYANGPIHLGHMLEAVQTDIWVRFQKMRGHDCVYVCADDAHGTAIMLR
AENEGITSEQLIDRVRAEHMASYAGFHIGFDNYHSTHSPENRHYSETIYKALRANNRIAT
RSIKQLFDPEKGLFLADRFVKGSCPKCKAEDQYGDNCEVCGATYSPAELINPRSTLSGAT
PVEKESEHYFFKLPEFTDFLKQWTRSGSLQPQVANKLAEWVEGGLQEWDISRDAPYFGFE
IPDAPGKYFYVWLDAPIGYMASFQALCDRTGRQFDDYWKPGSQAELYHFIGKDIINFHAL
FWPSMLSDSGYRTPTAVFAHGFMTVNGKKMSKSRGTFINADTYLQHLDAEFLRYFLASRL
GGGVDDLDLSFDDFLAKVNADVVGKLVNIASRCAGFISKGFEGRLAEELANPELLAQAQQ
AAESIATAYEEREYHRAIRQIMALADQANSYIAEQQPWVLAKQNPQDPQVQAICSTGINL
FRLLMIYLKPVLPAMAEKVEAFLQVQPLQWRDAASLLTDHVIDSFKPLARRAEAAQVEAL
LASTREEAEQTRKLTAAPVDQVAASTVTGEQTVDSQLAKEPIAEEITFDDFIKVDLRVAR
IIKADYVEGADKLLQLTLDLGPDANGEGVVRNVFSGIRSAYTPEALEGRLTVLAANLKPR
KMKFGLSEGMVLAAGPGGEDIFLLSPDSGAQPGMRIV
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacgccaaattcttgtcaccagcgctctgccatacgccaatggacctatccat
ctggggcatatgctggaagccgtgcaaaccgacatctgggtgcgcttccagaagatgcgc
gggcatgactgtgtgtatgtgtgcgccgacgatgcccatggcacagctatcatgctgcgt
gccgagaacgagggcatcacgtctgagcagctgattgacagggtgcgcgcggagcacatg
gcgtcctatgccggtttccacattggttttgacaactaccattccacgcattcgccggaa
aaccgtcactattcggaaacgatttataaggcgctgcgggcgaataaccgcatcgccacg
cgcagtatcaaacaactgtttgatccggagaaaggtctgtttctggctgaccgctttgtg
aagggcagctgcccgaaatgcaaggcggaggatcagtatggtgacaactgcgaagtctgc
ggtgcgacctatagtccggcggagctgattaacccgcgctccaccttgtctggcgctacg
ccggtggaaaaagaatccgagcattatttcttcaagctgccggagttcactgactttctc
aagcaatggacgcgcagcggcagcctgcagccgcaggtggccaacaagctggcggagtgg
gtggaaggcggcctgcaggagtgggatatcagccgtgatgcgccttatttcggcttcgaa
attcctgatgcaccgggcaaatatttttatgtgtggctggatgcgcccatcggttatatg
gccagttttcaggcgctgtgtgacagaacaggtcgccagtttgatgactactggaagccg
ggcagccaggccgagctgtatcactttattggcaaggacattatcaatttccacgcactg
ttctggccctccatgctgagtgattcaggctaccgaacgcccaccgcggtgtttgcgcat
ggttttatgacggtcaatggcaagaaaatgtccaaatcacggggcactttcatcaatgcg
gacacctatctgcagcatctggatgccgaatttctgcgctactttctggcatcgcgcctg
ggcggcggcgttgacgatttggatctgagctttgatgattttctggccaaggtaaacgcc
gatgtggtgggcaagctggtgaatatcgccagtcgctgtgccggcttcatcagcaagggt
tttgagggcagactggccgaggagctggccaatccggaattgctggcccaggcgcagcag
gctgccgagagcatcgccacggcctatgaagagcgggaatatcaccgcgccatccgtcag
atcatggcgctggctgatcaggcgaattcgtacattgccgagcagcagccctgggtgctg
gccaaacagaacccgcaggaccctcaggtacaggccatctgttcaaccgggatcaacctg
ttccgcttgctgatgatttacctgaaaccggtgctgccggcgatggccgagaaggtggaa
gcatttttacaggtgcagcctctgcagtggcgtgatgcggccagcctgctgactgatcat
gtgatagacagcttcaagccgctggctcgccgcgcggaagcggcgcaggtggaggctttg
ctggcatccacccgcgaagaagcggaacaaacccgtaaattgacagcggcgcctgtggat
caggttgctgcgtcgactgtgacaggagagcaaaccgtggacagccagctggctaaggaa
ccgattgctgaggaaatcaccttcgacgactttatcaaggtggatttgcgtgtggcgcgc
atcatcaaggctgactatgtggaaggcgccgacaagctgctgcaactgacactggacctt
ggccccgacgccaacggtgagggcgtggtgcgcaatgtcttttccggcatacgttcggct
tatacaccggaggctctggagggtcggctgacggtgcttgcggccaacctgaaaccgcgc
aaaatgaaattcggcctgtccgaaggcatggtgctggcggccggtcccggtggtgaagac
atctttctgctgagcccggacagcggcgcacaaccgggcatgcgtattgtctga

DBGET integrated database retrieval system