KEGG   Pseudohongiella spirulinae: PS2015_2120Help
Entry
PS2015_2120       CDS       T04158                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00620  Pyruvate metabolism
pspi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PS2015_2120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pspi02000]
    PS2015_2120
Enzymes [BR:pspi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PS2015_2120
Transporters [BR:pspi02000]
 Other transporters
  Primary active transporters [TC:3]
   PS2015_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 DUF2118 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ALO46758
UniProt: A0A0S2KEJ3
Position
complement(2312532..2314328)
Genome map
AA seq 598 aa AA seqDB search
MSDSKKPLAITDVILRDAHQSLLATRMRLDDMLPIADKLDKVGLWAVESWGGATFDACIR
YLGEDPWERIRKLKEAMPNTRQQMLFRGQNILGYRHYADDIVDRFVERAAVNGVDVFRVF
DAMNDVRNLETAIKSVRKHEKHAQGTMSYTVSPVHTLDSWLQMARQIEEMGAESLCIKDM
AGLLAPYTAYELITNLKKTVSIPIHMQCHATTGLSTATYIKAVEAGIDNLDTAISSMSLT
YGHTPTETMVAMLQGTDRDTGLDIVLLEEIASYFRQVRKKYARFEGALKGIDSRILVAQV
PGGMLTNLENQLREQNATDRLDEVLEEIPKVRKDLGYIPLVTPTSQIVGTQAVLNVLSGE
RYKNITKETEGVLKGEYGATPAPVNEALQQAVLQGGEAITCRPADLLDPEFERLQRELLE
LADKEKFEIVNGIDDTLSYALFPQVALKFFRNRNNPDAFEPAPSEEPPTEPTNAKTARKK
PAQDGVYTVEVDGTAYVVKVTEGGELTDIANKNVANNASDVSQTSDTEGHDVNAPLSGTV
HKLMVNEGDTVASGDVLMVLEAMKMETEIRSSKDGVVVVIHVDEGETVSSGDVLVTLE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactccaaaaagcctctggcaattactgatgtcattcttcgcgacgcgcaccag
tccttacttgctacgcgaatgcgactggacgatatgctgcccattgcggacaaactcgat
aaggttggtctgtgggcagttgagtcctggggtggagcaacatttgatgcctgtatccgc
tatttgggtgaagatccctgggaaaggataagaaaactgaaagaggccatgcccaatacg
cgtcaacaaatgctgttccgcggacagaatattttgggttatcgacattatgcggacgac
attgtcgatcgatttgtcgagcgtgccgcggtaaatggggtagatgtctttcgtgtattt
gacgccatgaacgatgtacgcaaccttgaaacagccatcaagtcagtacgtaaacatgag
aagcatgcgcagggcaccatgtcatacaccgtcagtccggtgcatacattggacagctgg
ttgcagatggcccgtcagatagaggagatgggggctgaatccttgtgtatcaaggatatg
gctggccttcttgcgccctatacagcctatgaattgatcactaacctgaaaaaaacagtg
tcgattccgattcatatgcaatgtcatgcaacgaccgggctgtctactgcgacttatatc
aaggctgtggaagcaggaattgacaatctggacacggcgatatcttccatgagcctgact
tatggtcatacccctacagaaacgatggtagcgatgctgcaaggcactgatcgtgatact
ggcctggatattgtgttgttggaagaaatagcatcttatttccggcaggtgcgcaaaaaa
tatgcccggttcgaaggggccctgaagggcattgactcgcgaattcttgtggctcaggtg
cctggcggcatgctgaccaatctcgagaaccagctgcgcgaacaaaacgcgactgaccgc
ctggatgaggtgttggaggaaatcccgaaagttcggaaagatctggggtatattcccctg
gtcacgccgacatcgcagatcgttggaacacaggcggttcttaatgtcctgtcgggtgag
cgttacaagaatattaccaaagaaactgaaggcgtcctgaaaggcgaatatggcgcgacg
cctgcgccggtcaatgaggcgttgcagcaggcggtcttgcagggcggcgaggcgatcacc
tgtcgtccggcagatctgctcgatccggagttcgagcgcttgcaaagagagttgctcgag
ctggccgacaaagaaaaatttgaaatagtaaatgggattgacgatacgctgagttatgcc
ctgttccctcaggtggcgctgaaattcttccgcaaccgtaacaatccagatgcatttgaa
ccggctccctcagaggagccacccactgaacccactaacgcgaagaccgctcgtaagaag
cctgcacaggatggcgtttacacggtcgaggtggatggtacagcctatgttgtcaaggta
accgaaggcggcgagctgacggacatcgctaataaaaacgtcgccaacaatgcttccgac
gtcagtcagacttcagacacagaaggtcatgacgtgaatgctccgctttcagggaccgta
cataaactgatggtcaatgagggtgatacggtagcatccggtgatgtcctgatggttctt
gaggcgatgaaaatggaaacggaaattcgcagtagtaaggatggcgtggttgtcgtgatt
catgtcgatgagggagaaactgtgtcctccggcgatgttctggtgacgctggagtag

DBGET integrated database retrieval system